FGF-21, murine recombinant

  • Catalog number
    4067-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    FGF21, Fibroblast growth factor 21, FGFL
  • Alternative_names
    FGF21, Fibroblast growth factor 21, FGFL, UNQ3115/PRO10196
  • Description
    A heparin binding growth factor, stimulating the proliferation and activation of cells expressing FGFR
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥95%
  • Assay
    SDS-PAGE
  • Purity
    ≥95%
  • Molecular Weight
    20.1 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized from filtered (0.4 mm) solution containing 20 mM Tris, pH 7.4 and 20 mM NaCl
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute in sterile H₂O to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffers.
  • Background Information
    The FGFs are a family of more than 20 small (~17–26 kDa) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. FGFR-2 appears to be a key molecule during pancreatic development and FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents. Fibroblast Growth Factor-21 Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 183 amino acids including N-terminal Methionine and having a molecular mass of 20.1 kDa. The amino acid sequence of the recombinant mouse FGF21 is 100% homologous to the amino acid sequence of the mouse FGF21 without signal sequence. The FGF-21 is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    MAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
  • Usage
    For Research Use Only! Not to be used in humans
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    FGF-21   murine  
  • Gene symbol
    FGF21, PIRC105, SNORD115-21, HTOR, FGF18, SNORD116-21, SNORD114-21, FGF17
  • Short name
    FGF-21, murine recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Alternative name
    FGF-21, murine Rec.
  • Alternative technique
    rec
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    piwi-interacting RNA cluster 105
  • Locus
    21
  • Discovery year
    2009-11-05
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Piwi-interacting RNA clusters
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    5-hydroxytryptamine (serotonin) oxygenase regulator
  • Locus
    21
  • Discovery year
    2001-06-22
  • Entrez gene record
  • Pubmed identfication
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Methods or procedures used to obtain samples of URINE.
  • Tree numbers
    • E01.370.225.998.762
    • E05.200.998.762
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee