Integrin beta 3 Antibody / ITGB3 / CD61
-
Catalog numberR31891
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenIntegrin beta 3 / ITGB3 / CD61
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB, IHC-P
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml,IHC (Paraffin): 0.5-1ug/ml
-
NotesOptimal dilution of the CD61 antibody should be determined by the researcher.
-
Intented useThis CD61 antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP05106
-
PurityAntigen affinity
-
DescriptionIntegrin beta 3, also called GP3A, GPIIIa, and CD61, is a protein that in humans is encoded by the ITGB3 gene. It is a cluster of differentiation found on thrombocytes. The 3-prime exon is larger than 1,700 nucleotides and contains the 3-prime untranslated region. The ITGB3 complex belongs to the integrin class of cell adhesion molecule receptors that share a common heterodimeric structure with alpha and beta subunits. Additionally, the ITGB3 complex mediates platelet aggregation by acting as a receptor for fibrinogen. Although the ITGB3 is expressed on the cell surface at normal levels and is capable of function following extracellular stimulation, it could not be activated via the 'inside-out' signaling pathways.
-
ImmunogenAmino acids FAKFEEERARAKWDTANNPLYKEATSTFTNITYR of human CD61 were used as the immunogen for the CD61 antibody.
-
StorageAfter reconstitution, the CD61 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
LocalizationCell surface, cytoplasmic
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolITGB3
-
Short nameAnti-Integrin beta 3 / ITGB3 / CD61
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to Integrin beta 3 / ITGB3 / CD61
-
Alternative techniqueantibodies
-
Alternative to gene targetintegrin, beta 3 (platelet glycoprotein IIIa, antigen CD61), BDPLT16 and BDPLT2 and CD61 and GP3A and GPIIIa and GT, ITGB3 and IDBG-547297 and ENSG00000259207 and 3690, cell adhesion molecule binding, nuclei
-
Gene info
-
Identity
-
Gene
-
Long gene nameintegrin subunit beta 3
-
Synonyms gene
-
Synonyms gene name
- integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year1988-06-09
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- Integrin beta subunits
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data