Recombinant Human Small Ubiquitin-Related Modifier 2/SUMO2 (N-6His)

  • Catalog number
    C176-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Human SUMO2 is produced by our E.coli expression system and the target gene encoding Met1-Gly93 is expressed with a 6His tag at the N-terminus.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MGSSHHHHHHSSGLVPRGSHMADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
  • Estimated molecular weight
    13 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P61956
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SUMO2
  • Short name
    Recombinant Ubiquitin- Modifier 2/SUMO2 (N-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human SUMO2/SMT3B(N-6His)
  • Alternative technique
    rec
Gene info
  • Identity
  • Gene
  • Long gene name
    small ubiquitin like modifier 2
  • Synonyms gene
  • Synonyms gene name
    • SMT3 (suppressor of mif two 3, yeast) homolog 2
    • SMT3 suppressor of mif two 3 homolog 2 (yeast)
    • SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
  • Synonyms
  • Locus
  • Discovery year
    1997-01-29
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee