CXCR4 Antibody

  • Catalog number
    A00031
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    CXCR4
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human CXCR4 (265-294aa ILLEIIKQGCEFENTVHKWISITEALAFFH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the CXCR4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The CXCR4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    CXCR4 (Chemokine,CXC Motif, Receptor 4), also known as FUSIN or NPY3R, is a protein that in humans is encoded by the CXCR4 gene. It is the receptor for the CXC chemokine SDF1 that has essential functions on embryo organogenesis, immunological functions and T lymphocyte trafficking. CXCR4 is the only SDF1 receptor identified so far. This suggests that CXCR4 expression is critical for the biological effects of SDF1. CXCR4 is also a seven-transmembrane-spanning, G-protein-coupled receptor for the CXC chemokine PBSF/SDF-1. It functions as a co-receptor for T-cell-line tropic human immunodeficiency virus HIV-1. It was concluded that PBSF/SDF-1 and CXCR4 define a new signalling system for organ vascularization.
  • Related articles
    1. Caruz, A.; Samsom, M.; Alonso, J. M.; Alcami, J.; Baleux, F.; Virelizier, J. L.; Parmentier, M.; Arenzana-Seisdedos, F. : Genomic organization and promoter characterization of human CXCR4 gene. FEBS Lett. 426: 271-278, 1998. 2. Tachibana, K.; Hirota, S.; Iizasa, H.; Yoshida, H.; Kawabata, K.; Kataoka, Y.; Kitamura, Y.; Matsushima, K.; Yoshida, N.; Nishikawa, S.; Kishimoto, T.; Nagasawa, T. : The chemokine receptor CXCR4 is essential for vascularization of the gastrointestinal tract. Nature 393: 591-594, 1998.
  • Gene Name
    CXCR4
  • Protein Name
    C-X-C chemokine receptor type 4
  • Gene Full Name
    chemokine (C-X-C motif) receptor 4
  • Synonyms
    C-X-C chemokine receptor type 4 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | Leukocyte-derived seven transmembrane domain receptor | LESTR Lipopolysaccharide-associated protein 3 | LAP-3 | LPS-associated protein 3 | NPYRL | Stromal cell-derived factor 1 receptor | SDF-1 receptor | CD184 | CXCR4 | P61073
  • Uniprot ID
    P61073
  • Entrez GeneID
    7852
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    CXCR4  
  • Gene symbol
    CXCR4
  • Short name
    CXCR4 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    chemokine (C-X-C motif) receptor 4 (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    chemokine (C-X-C motif) receptor 4, CD184 and D2S201E and FB22 and HM89 and HSY3RR and LAP-3 and LAP3 and LCR1 and LESTR and NPY3R and NPYR and NPYRL and NPYY3R and WHIM, CXCR4 and IDBG-71032 and ENSG00000121966 and 7852, ubiquitin binding, Cell surfaces, Cxcr4 and IDBG-189999 and ENSMUSG00000045382 and 12767, CXCR4 and IDBG-642187 and ENSBTAG00000001060 and 281736
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee