CXADR Blocking Peptide

• Catalog number
  33R-4065
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Infectious Disease
• Tag Conjugate
  ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  CXADR  
• Gene symbol
  CXADR
• Short name
  CXADR Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  coxsackie virus and adenovirus receptor inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  coxsackie virus and adenovirus receptor, CAR and CAR4/6 and HCAR, CXADR and IDBG-854 and ENSG00000154639 and 1525, connexin binding, nuclei, Gm1123 and IDBG-192613 and ENSMUSG00000044860 and 382097, CXADR and IDBG-630474 and ENSBTAG00000004869 and 281733

Gene info

• Identity
  HGNC:2559
• Gene
  CXADR
• Long gene name
  CXADR Ig-like cell adhesion molecule
• Synonyms gene name
  • coxsackie virus and adenovirus receptor
  • CXADR, Ig-like cell adhesion molecule
• Synonyms
  • CAR
• GenBank acession
  • Y07593
• Locus
  21q21.1
• Discovery year
  1998-03-24
• Entrez gene record
  1525
• Pubmed identfication
  • 9036860
  • 9096397
  • 20813955
• Classification
  • IgCAM CXADR-related subfamily
  • V-set domain containing
• VEGA ID
  OTTHUMG00000074508

Similar products