Rabbit PCDHGB1 antibody
-
Catalog number70R-6147
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD
-
SpecificityPCDHGB1 antibody was raised against the N terminal of PCDHGB1
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGB1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolPCDHGB1
-
Short nameRabbit PCDHGB1 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PCDHGB1 antibody raised against the N terminal of PCDHGB1
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetprotocadherin gamma subfamily B, 1, PCDHGB1 and IDBG-408879 and ENSG00000254221 and 56104, calcium ion binding, Plasma membranes, PCDHGB2 and IDBG-646107 and ENSBTAG00000037968 and 100848197
-
Gene info
-
Identity
-
Gene
-
Long gene nameprotocadherin gamma subfamily B, 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-06-28
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Clustered protocadherins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data