Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human GABA A Receptor Associated Protein GABARAP N

Recombinant Human GABA A Receptor Associated Protein GABARAP N is available 8 times from Novo labs

CH32-1000 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc) size: 1 mg | 2,585.50 USD

Loading

CH32-10 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc) size: 10 ug | 177.80 USD

Loading

CH32-50 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc) size: 50 ug | 419.03 USD

Loading

CH32-500 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc) size: 500 ug | 1,827.86 USD

Description Recombinant Human GABARAP is produced by our E.coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus, Fc tag at the C-terminus.
Peptide sequence MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Estimated molecular weight 43,2 kDa
Shipping condition Dry ice/ice packs
Package form Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,20% glycerol,pH7.0.
Storage conditions Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene targetGABA(A Receptor-Associated Protein/GABARAP N-6His C-Fc
Short name Recombinant GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc)
Technique Recombinant, FC
Alternative name recombinant H. sapiens GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-fragment c)
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C143-1000 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-GST) size: 1 mg | 379.39 USD

Loading

C143-10 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-GST) size: 10 ug | 69.08 USD

Loading

C143-50 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-GST) size: 50 ug | 91.73 USD

Loading

C143-500 | Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-GST) size: 500 ug | 281.99 USD

Loading
Species reactivity Human
Origin Escherichia coli
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
UniProt number Q6IAW1
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Description The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
Source Recombinants or rec. proteins
Group recombinants
Species Human
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human GABA(A) Receptor-Associated Protein/GABARA
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
  • GABA(A
  • Receptor-Associated
  • Protein/GABARAP
  • N-6His
  • C-Fc
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee