Recombinant Human GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc)

• Catalog number
  CH32-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human GABARAP is produced by our E.coli expression system and the target gene encoding Met1-Gln116 is expressed with a 6His tag at the N-terminus, Fc tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MGSSHHHHHHSSGLVPRGSHMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGLVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Estimated molecular weight
  43,2 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,20% glycerol,pH7.0.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  Q6IAW1
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  GABA   Receptor-Associated   Protein/GABARAP   N-6His   C-Fc  
• Gene symbol
  GABARAP, ABAT
• Short name
  Recombinant GABA(A) Receptor-Associated Protein/GABARAP (N-6His, C-Fc)
• Technique
  Recombinant, FC, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human GABARAP(N-6His, C-Fc)
• Alternative technique
  rec

Gene info

• Identity
  HGNC:4067
• Gene
  GABARAP
• Long gene name
  GABA type A receptor-associated protein
• Synonyms gene name
  • GABA(A) receptor-associated protein
• Synonyms
  • MM46
  • ATG8A
• GenBank acession
  • AF161586
• Locus
  17p13.1
• Discovery year
  1999-09-29
• Entrez gene record
  11337
• Pubmed identfication
  • 9892355
• Classification
  • Autophagy related
• VEGA ID
  OTTHUMG00000102156

Gene info

• Identity
  HGNC:23
• Gene
  ABAT
• Long gene name
  4-aminobutyrate aminotransferase
• Synonyms
  • GABAT
  • GABA-T
• Synonyms name
  • 4-aminobutyrate transaminase
  • gamma-aminobutyrate aminotransferase
  • GABA transaminase
• GenBank acession
  • L32961
• Locus
  16p13.2
• Discovery year
  1996-03-13
• Entrez gene record
  18
• Pubmed identfication
  • 7721088
• RefSeq identity
  • NM_020686
• VEGA ID
  OTTHUMG00000048201

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products