Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Attachment invasion locus protein ail

Recombinant Attachment invasion locus protein ail is available 6 times from Bioma labs

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 1 mg | 2243.53 USD

Expected molecular weight 33.21kDa
MeSH Data
Concept
Scope note:The initial culturing of cells derived directly from fresh TISSUES.
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Additional information

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 200 μg | 965.77 USD

Loading

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 50 μg | 427.83 USD

Loading

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 100 μg | 638.88 USD

Loading

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 500 μg | 1502.57 USD

Loading

RPC20529 | Recombinant Attachment invasion locus protein(ail) size: 10 μg | 222.52 USD

Loading
Other name no alternative name
Protein origin E.coli
Estimated production time 7-11 business days
Gene number ail
Gene name ail
Protein number P16454
Protein sequence ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF
Notes For research use only. Not for diagnostic procedures.
Use before 1 year
Information about sequence Full Length of Mature Protein
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Shipping requirements Blue ice
Verified reactivity Yersinia enterocolitica
Protein purity ≥ 90%
Protein region 24-178aa
Source Recombinants or rec. proteins
Group recombinants
Short name Recombinant Attachment invasion locus protein(ail)
Technique Recombinant
Alternative name recombinant Attachment invasion locus protein(ail)
Alternative technique rec
Similar products
Recombinant Attachment invasion locus protein ail Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Attachment invasion locus protein ail Suppplier: Biomatik
Price: 0.00 USD
Attachment invasion locus protein ail Suppplier: MBS Recombinant
Price: 1 730.82 USD
Recombinant Mycobacterium phage D29 Minor tail protein Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Chicken Homeobox protein engrailed 1 EN1 Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Enterobacteria phage lambda Tail protein Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Attachment invasion locus protein ail
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee