Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

SHP2 Antibody

SHP2 Antibody is available 3 times from Boster labs

PA1860 | SHP2 Antibody size: 0,1 mg | 359.23 USD

Loading

PA1114 | SHP2 Antibody size: 0,1 mg | 359.23 USD

Loading

PB9675 | SHP2 Antibody size: 0,1 mg | 419.85 USD

Catalog number PB9675
Supplier boster
Price 419.85 USD
Size 0,1 mg
Reacts with species: human, mouse, rat
Analyses WB,IHC-P
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
Product configuration Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Background PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
Related articles 1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.
Synonyms BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody
Entrez GeneID 5781
1. Gene info
Identity 9644
Gene PTPN11
Long gene name protein tyrosine phosphatase, non-receptor type 11
Synonyms gene
  • NS1
Synonyms gene name
  • Noonan syndrome 1
Synonyms
  • BPTP3
  • SH-PTP2
  • SHP-2
  • PTP2C
  • SHP2
GenBank acession
  • D13540
Locus 12q24.13
Discovery year 1993-03-03
Entrez gene record 5781
Pubmed identfication
  • 7894486
  • 1280823
Classification
  • Protein tyrosine phosphatases, non-receptor type
  • SH2 domain containing
Havana BLAST/BLAT OTTHUMG00000134334
Locus Specific Databases
  • LRG_614
2. Gene info
Identity 17710
Gene SIT1
Long gene name signaling threshold regulating transmembrane adaptor 1
Synonyms gene name
  • suppression inducing transmembrane adaptor 1
Synonyms
  • SIT
Synonyms name
  • SHP2 interacting transmembrane adaptor
Locus 9p13.3
Discovery year 2005-04-25
Entrez gene record 27240
Pubmed identfication
  • 11491537
  • 10209036
RefSeq identity
  • NM_014450
Havana BLAST/BLAT OTTHUMG00000019867
MeSH Data
Name Blotting, Western
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
Clonality Polyclonal antibody
Storage condtions Keep the SHP2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
Purification Immunogen affinity purified.
Raised in rabbit
Solubilization The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Target antigen SHP2
Product form freeze-dried
Gene Name PTPN11
Gene Full Name protein tyrosine phosphatase, non-receptor type 11
Type of the antibody IgG polyclonal antibody
Uniprot ID Q06124
Clone Polyclonal antibody
Tips The SHP2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Protein Name Tyrosine-protein phosphatase non-receptor type 11
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetSHP2
Short name SHP2 Antibody
Technique Antibody
Alternative name SHP2 (Antibody to)
Alternative technique antibodies
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
SHP2 Antibody cat.: PB9675 - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]r.com
  • SHP2
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee