-
Target antigen
SHP2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the SHP2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The SHP2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
-
Related articles
1. Higashi, H., Tsutsumi, R., Muto, S., Sugiyama, T., Azuma, T, Asaka, M., Hatakeyama, M. SHP-2 tyrosine phosphatase as an intracellular target of Helicobacter pylori CagA protein. Science 295: 683-686, 2002.
-
Gene Name
PTPN11
-
Protein Name
Tyrosine-protein phosphatase non-receptor type 11
-
Gene Full Name
protein tyrosine phosphatase, non-receptor type 11
-
Synonyms
BPTP 3 antibody|BPTP3 antibody|CFC antibody|MGC14433 antibody|Noonan syndrome 1 antibody|Noonan syndrome 1 protein tyrosine phosphatase 2C antibody|NS 1 antibody|NS1 antibody|OTTHUMP00000166107 antibody|OTTHUMP00000166108 antibody|Protein tyrosine phosphatase 2 antibody|Protein tyrosine phosphatase 2C antibody|Protein Tyrosine Phosphatase Non receptor Type 11 antibody|Protein-tyrosine phosphatase 1D antibody|Protein-tyrosine phosphatase 2C antibody|PTN11_HUMAN antibody|PTP 1D antibody|PTP 2C antibody|PTP-1D antibody|PTP-2C antibody|PTP1D antibody|PTP2C antibody|PTPN 11 antibody|PTPN11 antibody|PTPN11 antibody|SAP2 antibody|SH PTP2 antibody|SH PTP3 antibody|SH-PTP2 antibody|SH-PTP3 antibody|SH2 domain containing protein tyrosine phosphatase 2 antibody|SHIP2 antibody|SHP 2 antibody|SHP-2 antibody|Shp2 antibody|SHPTP 2 antibody|SHPTP2 antibody|SHPTP3 antibody|SIT protein precursor antibody| Syp antibody|Tyrosine protein phosphatase non receptor type 11 antibody|Tyrosine-protein phosphatase non-receptor type 11 antibody
-
Uniprot ID
Q06124
-
Entrez GeneID
5781
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
