IL-17A/F, human recombinant

  • Catalog number
    4176AF-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF
  • Alternative_names
    IL17A/F, IL17 A/F, IL-17A/F Interleukin-17 A/F, Interleukin-17 AF, Cytotoxic T-lymphocyte-associated antigen 8
  • Description
    A proinflammatory cytokine produced by activated T cells
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥98%
  • Assay
    SDS-PAGE
  • Molecular Weight
    30.7 kDa
  • Storage Temp
    -20°C
  • Shipping
    Gel pack
  • Shelf Life
    12 months
  • Appearance
    Lyophilized protein
  • Physical form description
    Lyophilized with no additives
  • Reconstitution Instructions
    Centrifuge the vial prior to opening. Reconstitute with sterile H₂O to a concentration not more than 1 mg/ml; This solution can then be diluted into other aqueous buffers.
  • Background Information
    Human IL-17A/F is a 40 kDa glycoprotein which is secreted as a disulfide-linked heterodimer. IL-17A/F consists of two proteins, IL-17A and IL17F. Human IL17A is produced as a 155 a.a precursor that includes a 23 amino acids signal sequence and a 132 amino acid chain that includes an N-linked glycosylation site. Human IL17F is produced as a 153 amino acid precursor with a 20 amino acid signal sequence and a 133 amino acid region and an N-linked glycosylation site. Both proteins (IL17A & IL17F) share 50 % amino acid sequence identity. Human IL17A & IL17F show approximately 60 % homology in their amino acid sequence to mouse IL-17A and IL-17F. Interleukin-17A/F and IL17A, IL17F homodimers are manufactured by activted CD4+ T cells, called Th17. IL-23 causes Th17 lymphocytes to manufacture IL-17A/F. Interleukin-17A/F induces chemokine production and airway neutrophilia with intermediate potency between IL17A (most potent) and IL17F (least potent). IL-17A/F Human Recombinant produced in E.Coli is a heterodimeric, non-glycosylated polypeptide chain containing 1 monomeric subunit of each IL-17A & IL-17F. The active dimer contains 271 amino acids and having a total molecular mass of 30.7 kDa. The IL-17A/F Human is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAMRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    IL17A, IL36G, IL25, IL22, IL18, IL37, IL6R, IL17C, IL17D, IL23A
  • Short name
    IL-17A/F, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Interleukin-17A/F, H. sapiens Rec.
  • Alternative technique
    rec
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee