-
Category
Primary Antibodies
-
Long description
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
-
Antibody come from
158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
-
Other description
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
-
Clone
158A3
-
Antigen antibody binding interaction
Mouse anti Integrin alpha 3A Antibody
-
Antibody is raised in
Mouse
-
Antibody s reacts with
Human, Canine
-
Antibody s reacts with these species
This antibody doesn't cross react with other species
-
Antibody s specificity
158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A.
-
Research interest
Cancer,Cell adhesion
-
Application
Immunocytochemistry,Immunohistochemistry (frozen),Western blotting
-
Antibody s suited for
158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration.
-
Storage
Store at 4°C, or in small aliquots at -20°C.
-
Relevant references
Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
-
Protein number
see ncbi
-
Warnings
This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
-
-
Description
The Mouse anti Integrin alpha 3A is a α- or alpha protein sometimes glycoprotein present in blood. This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus