Rat IL23 ELISA kit

  • Catalog number
    55R-2167
  • Price
    Please ask
  • Size
    96 tests
  • Category
    Research kit
  • Area of research
    Cytokines & Growth Factors
  • Specificity
    Rat IL23
  • Residues
    GKFMKPGKVVLVLAGRYSGALKRKARREAKVKFEERYKTGKNKWFFQKLRFRKAVIVKNIDDGTSDRPYSHALVAGIDRYPRKVTAAMGKKKIAKRSKIKSF  VKVYNYNHLMPTRYSVDIPLDKTVVNKDVFRDP
  • Storage
    Store unopened kit at 2-8 deg C, do not use past expiration date
  • Tested for
    ELISA
  • Assay Information
    Detection Range: 3.12 pg/ml-200 pg/ml; Sensitivity: 0.78 pg/ml; Compatible Sample Types: serum, plasma,cell culture supernates, tissue homogenates; Assay Time: 1-5 hours; Sample Volume: 50-100 ul; Detection Wavelength: 450 nm
  • URL
  • Properties
    E05 478 566 350 170 or Enzyme-Linked Immunosorbent Assays, E05 478 566 350 170 or Enzyme-Linked Immunosorbent Assays
  • Test
    ELISA Enzyme-linked immunosorbent assays Code 90320007 SNOMED
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Gene target
    IL23  
  • Short name
    IL23 ELISA kit
  • Technique
    ELISA kit, ELISA, ELISAs Enzyme-linked immunosorbent assay 90320007 SNOMED code are used by the medical researcher for detection of human, mouse, … proteins are supplied in coated 96 well plates to be stored at +4°C. ELISA test kits can be sandwich ELISA. In sandwich ELISAS Enzyme-linked immunosorbent assay 9we use captor and detector antibodies. In single antibody ELISAs the antigen is coated and only a detector antibody is used. Traditional competition antigen ELISAs are coated with a captor antibody and a competitive antigen is labelled with the chromogen. In this case the ratio on your graph will be inverse proportional with the antigen present in your sample. A sign detected by the Colorimetric detection OD optical density absorbance at 450 nm between 0 and 4 with an ELISA reader for 450 nm absortion. Genprice Inc. the recognized authority tax ID 45-4304622 D-U-N-S number - 078440800. MeSH code E05 478 566 350 170 Enzyme-Linked Immunosorbent Assay. PROMT code 3841327 Immunoabsorbent assay tests. ELISA tests are enzyme linked immunoassays to detect human, mouse or other proteins in serum, plasma, urine or biological fluids. MeSH code E05 478 566 350 170 for Enzyme-Linked Immunosorbent Assay or ELISA kits. Also Enzyme-linked immunoassay, competitive have the SNOMED name 61461007 and the PROMT code for ELISA readers is 3841330. This is the desigation of other diagnostic analyzers and tests.
  • Host
    Rat, antigen assay ELISA kit 1 Kit (96 Wells)
  • Species
    Rat, Rats
  • Alternative name
    ELISA Kit for detection of IL23 in the research laboratory
  • Alternative technique
    elisas, kits
  • Alternative to gene target
    v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, C-Kit and CD117 and PBT and SCFR, KIT and IDBG-18980 and ENSG00000157404 and 3815, transferase activity, Extracellular, Kit and IDBG-172083 and ENSMUSG00000005672 and 16590, KIT and IDBG-642326 and ENSBTAG00000002699 and 280832
MeSH Data
  • Name
  • Concept
    Scope note: An immunoassay utilizing an antibody labeled with an enzyme marker such as horseradish peroxidase. While either the enzyme or the antibody is bound to an immunosorbent substrate, they both retain their biologic activity; the change in enzyme activity as a result of the enzyme-antibody-antigen reaction is proportional to the concentration of the antigen and can be measured spectrophotometrically or with the naked eye. Many variations of the method have been developed.
  • Tree numbers
    • E05.478.566.350.170
    • E05.478.566.380.360
    • E05.478.583.400.170
    • E05.601.470.350.170
    • E05.601.470.380.360
  • Qualifiers
    ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee