-
Target antigen
SCARB1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the SCARB1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The SCARB1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Scavenger receptor class B member 1 (SRB1), also known as SR-BI, is a protein that in humans is encoded by the SCARB1 gene. SR-BI functions as a receptor for high-density lipoprotein. Scavenger receptor class B, type I (SR-BI) is an integral membrane protein found in numerous cell types/tissues, including the liver and adrenal. It is best known for its role in facilitating the uptake of cholesteryl esters from high-density lipoproteins in the liver. This process drives the movement of cholesterol from peripheral tissues towards the liver for excretion. This movement of cholesterol is known as reverse cholesterol transport and is a protective mechanism against the development of atherosclerosis, which is the principal cause of heart disease and stroke. SR-BI has also been identified in the livers of non-mammalian species (turtle, goldfish, shark, chicken, frog, and skate), suggesting it emerged early in vertebrate evolutionary history. The turtle also seems to upregulate SB-RI during egg development, indicating that cholesterol efflux may be at peak levels during developmental stages.
-
Related articles
1. "Entrez Gene: SCARB1 Scavenger receptor class B, member 1". 2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). "Identification of scavenger receptor SR-BI as a high density lipoprotein receptor".Science 271 (5248): 518–20. 3. Duggan AE, Marie RS, Callard IP (April 2002). "Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates". J. Exp. Zool.292 (5): 430–4.
-
Gene Name
SCARB1
-
Protein Name
Scavenger receptor class B member 1
-
Gene Full Name
scavenger receptor class B, member 1
-
Synonyms
CD36 AND LIMPII ANALOGOUS 1 antibody|CD36 antibody|CD36 Antigen like 1 antibody|CD36 antigen-like 1 antibody|CD36L1 antibody|CLA 1 antibody|CLA-1 antibody|CLA1 antibody| Collagen type I receptor antibody|HDLQTL6 antibody|MGC138242 antibody|SCARB1 antibody| Scavebger Receptor Class B Member 1 antibody|Scavenger receptor class B member 1 antibody| Scavenger Receptor Class B Type 1 antibody|SCRB1_HUMAN antibody|SR BI antibody|SR-BI antibody|SRB1 antibody|SRBI antibody|Thrombospondin receptor like 1 antibody|thrombospondin receptor-like 1 antibody
-
Uniprot ID
Q61009
-
Entrez GeneID
20778
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
