Recombinant Mouse CD63 antigen(Cd63) ,partial

  • Catalog number
    RPC20019
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P41731
  • Gene name
    Cd63
  • Other name
    CD63
  • Protein origin
    E.coli
  • Protein region
    103-203aa
  • Protein sequence
    AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI
  • Information about sequence
    Extracellular Domain
  • Expected molecular weight
    15,6kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    CD63   Cd63   partial  
  • Gene symbol
    CD63-AS1, CD63
  • Short name
    Recombinant Mouse CD63 antigen(Cd63) ,partial
  • Technique
    Recombinant, antigen, Mouse, antigenes, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal GST-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse CD63 molecule protein(CD63 molecule) ,partial
  • Alternative technique
    rec, antigenes, murine
  • Alternative to gene target
    CD63 molecule, LAMP-3 and ME491 and MLA1 and OMA81H and TSPAN30, CD63 and IDBG-38974 and ENSG00000135404 and 967, protein binding, Cell surfaces, Cd63 and IDBG-198573 and ENSMUSG00000025351 and 12512
Gene info
  • Identity
  • Gene
  • Long gene name
    CD63 antisense RNA 1
  • Locus
  • Discovery year
    2021-01-20
  • Entrez gene record
  • Classification
    • Antisense RNAs
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee