Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL7R alpha Antibody

IL7R alpha Antibody is available 1 time from Boster labs

PB9948 | IL7R alpha Antibody size: 0,1 mg | 430.29 USD

Loading
Clonality Polyclonal antibody
Entrez GeneID 3575
Analyses WB
Related articles 1. "Entrez Gene: IL7R interleukin 7 receptor". 2. Kroemer RT, Richards WG (December 1996). "Homology modeling study of the human interleukin-7 receptor complex".Protein Eng. 9 (12): 1135–42. 3. O'Doherty C, Alloza I, Rooney M, Vandenbroeck K (November 2009). "IL7RA polymorphisms and chronic inflammatory arthropathies". Tissue Antigens 74 (5): 429–31.
Raised in rabbit
Solubilization The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Target antigen IL7R alpha
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Type of the antibody IgG polyclonal antibody
Uniprot ID P16871
Clone Polyclonal antibody
Protein Name Interleukin-7 receptor subunit alpha
Synonyms CD 127 | CD127 | CD127 antigen | IL 7R alpha | IL-7R-alpha | IL 7R | IL7R | IL-7RA | IL7RA | IL7Ralpha | ILRA | Interleukin 7 receptor | P16871
Storage condtions Keep the IL7R alpha Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
Purification Immunogen affinity purified.
Background The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).
Product form freeze-dried
Gene Name IL7R
Gene Full Name interleukin 7 receptor
Product configuration Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reacts with species: human, mouse, rat
Tips The IL7R alpha Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Description The IL7R alpha Antibody is a α- or alpha protein sometimes glycoprotein present in blood.
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetIL7R alpha
Short name IL7R alpha Antibody
Technique Antibody
Alternative name interleukin 7 receptor a (Antibody to)
Alternative technique antibodies
Alternative to gene target interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554
Similar products
Anti IL7R alpha Antibody Suppplier: MyBioSource
Price: 0.00 USD
anti Silicatein alpha Antibody Suppplier: acr
Price: 341.70 USD
MaxiK alpha Antibody Suppplier: SAB
Price: 390.02 USD
Anti-HIF-1alpha Polyclonal Antibody Suppplier: aviva
Price: 487.81 USD
HIF1 alpha Antibody Suppplier: aviva
Price: 487.81 USD
Rabbit PKA alpha antibody Suppplier: fitzgerald
Price: 627.02 USD
Rabbit IL22 Receptor alpha 2 antibody Suppplier: fitzgerald
Price: 627.02 USD
Mouse alpha B Glycoprotein antibody Suppplier: fitzgerald
Price: 511.97 USD
ATPase alpha 1 Na K Antibody Suppplier: MBS Polyclonals
Price: 490.11 USD
Goat Anti-Afamin / alpha Albumin Antibody Suppplier: aviva
Price: 487.81 USD
GSK3 alpha Antibody Suppplier: EnoGene
Price: 339.40 USD
AChRalpha10 Polyclonal Antibody Suppplier: MyBioSource
Price: 197.89 USD
Tubulin alpha 8 Antibody Suppplier: abbex
Price: 467.10 USD
Hsp90 alpha Antibody Alkaline Phosphatase Suppplier: MBS Monoclonals
Price: 629.32 USD
Anti DGK alpha Antibody Suppplier: MyBioSource
Price: 0.00 USD
TCP1 alpha Antibody Suppplier: NJS poly
Price: 467.10 USD
Ask
Ajax processing
Close
IL7R alpha Antibody - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee