Yeast Recombinant AHA1 Protein

  • Catalog number
    SPR-314B
  • Price
    Please ask
  • Size
    100 µg
  • Stock availability
    In Stock
  • Scientific context
    Aha1 is a member of the HSP90 cochaperone family, and is thought to stimulate HSP90 ATPase activity by competing with p23 and other co-chaperones for HSP90 binding (1, 2). It may affect a step in the endoplasmic reticulum to Golgi trafficking. Aha1 also interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatistis virus glycoproteins (VSV G) (3). Aha1 is expressed in numerous tissues, including the brain, heart, skeletal muscle, and kidney, and at low levels, the liver and placenta. Aha1 might be a potential therapeutic strategy to increase sensitivity to HSP inhibitors (4).
  • Protein target
    AHA1
  • Protein reactivity
    Yeast
  • Certificate of analysis
    This product has been certified >90% pure using SDS - PAGE analysis.
  • Protein description
    Yeast Recombinant AHA1 Protein
  • Other name
    Aha1 Protein, SHSA1 Protein, HSPC322 Protein, p38 Protein
  • Primary research area
    Cancer, Heat Shock, Cell Signaling, Trafficking, Chaperones
  • Category
    Protein
  • Brand name
    none
  • Origin
    Recombinant
  • NCBI number
    NM_001180522.1
  • Gene number
    851800
  • Protein number
    Q12449
  • Verified applications
    WB, SDS-PAGE, Functional Assay
  • Relevant bio activity
    AHA1 Protein
  • Protein expression model
    E. coli
  • Protein charasterics
    See included datasheet.
  • Peptide sequence
    MGHHHHHHMVVNNPNNWHWVDKNCIGWAKEYFKQKLVGVEAGSVKDKKYAKIKSVSSIEGDCEVNQRKGKVISLFDLKITVLIEGHVDSKDGSALPFEGSINVPEVAFDSEASSYQFDISIFKETSELSEAKPLIRSELLPKLRQIFQQFGKDLLATHGNDIQVPESQVKSNYTRGNQKSSFTEIKDSASKPKKNALPSSTSTSAPVSSTNKVPQNGSGNSTSIYLEPTFNVPSSELYETFLDKQRILAWTRSAQFFNSGPKLETKEKFELFGGNVISELVSCEKDKKLVFHWKLKDWSAPFNSTIEMTFHESQEFHETKLQVKWTGIPVGEEDRVRANFEEYYVRSIKLTFGFGAVL
  • Protein purification
    Affinity Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    12.5mM Hepes buffer pH7.2, 10mM NaCl, 50% glycerol
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~405 kDa
  • Protein tag
    His tag
  • Storage recommendations
    -20°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Cytoplasm
  • Bibliography
    1. Hainzl O., Lapina M.C., Buchner J., Richter K. (2009) J Biol Chem. Epub. 2. Harst A., Lin H., Obermann W.M. (2005) Biochem J. 387 (pt.3): 789-796. 3. Lotz G.P., Brychzy A., Heinz S., Obermann W.M. (2008) J Cell Sci. 121(pt.5): 717-723. 4. Holmes J.L., Sharp S.Y., Hobbs S., Workman P. (2008) Cancer Res. 68(4): 1188-1197.
  • Release date
    1-Aug-2011
  • PubMed number
    Not added. Please refer to PubMed
  • Tested applications
    to be tested
  • Tested species reactivity
    to be tested
  • Representative figure legend
    SDS-PAGE of ~38kDa his-tagged mouse Aha2 protein (SPR-314). SDS-Page of yeast AHA2 Protein (SPR-314)
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.1
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Yeast   AHA1   Protein  
  • Gene symbol
    AHSA1, AHSA2P
  • Short name
    Yeast Recombinant AHA1 Protein
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. StressMark proteins advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Yeast, Ascomycota
  • Species
    Yeast, Yeasts
  • Alternative name
    Yeast Rec. AHA1 Protein
  • Alternative technique
    rec
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee