Rabbit SERPINE1 antibody

• Catalog number
  70R-5427
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Proteases, Inhibitors, & Enzymes
• Immunogen
  SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM
• Specificity
  SERPINE1 antibody was raised against the C terminal of SERPINE1
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINE1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  SERPINE1  
• Gene symbol
  SERPINE1
• Short name
  Rabbit SERPINE1 antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal SERPINE1 antibody raised against the C terminal of SERPINE1
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1, PAI and PAI-1 and PAI1 and PLANH1, SERPINE1 and IDBG-32959 and ENSG00000106366 and 5054, protein binding, Extracellular, Serpine1 and IDBG-204786 and ENSMUSG00000037411 and 18787, SERPINE1 and IDBG-640415 and ENSBTAG00000014465 and 281375

Gene info

• Identity
  HGNC:8583
• Gene
  SERPINE1
• Long gene name
  serpin family E member 1
• Synonyms gene
  • PLANH1
  • PAI1
• Synonyms gene name
  • serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
• Synonyms
  • PAI
• Synonyms name
  • plasminogen activator inhibitor, type I
• GenBank acession
  • M16006
• Locus
  7q22.1
• Discovery year
  1986-01-01
• Entrez gene record
  5054
• Pubmed identfication
  • 3097076
  • 2891140
  • 24172014
• RefSeq identity
  • NM_000602
• Classification
  • Serpin peptidase inhibitors
• VEGA ID
  OTTHUMG00000157107
• Locus Specific Databases
  • LRG_597

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products