Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand/FLT3LG (C-6His)
-
Catalog number
CA82-50
-
Price
Please ask
-
Size
50 ug
-
-
Description
Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding Thr27-Pro184 is expressed with a 6His tag at the C-terminus.
-
Species reactivity
Human
-
Origin
Human cells
-
Peptide sequence
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH
-
Estimated molecular weight
18,9 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,pH8.0.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
P49771
-
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Additional description
FAS ligand and other ligands are binding to the receptor for signaling pathways for example in apoptosis or JNK signaling. Receptor agonists are often tested for drug development.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
FLT3LG
-
Short name
Recombinant Fms- Tyrosine Kinase 3 Ligand/FLT3LG (C-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human Flt3 Ligand/FLT3LG(C-6His)
-
Alternative technique
rec
-
Alternative to gene target
fms-related tyrosine kinase 3 ligand, FL and FLT3L, FLT3LG and IDBG-62803 and ENSG00000090554 and 2323, protein homodimerization activity, Extracellular, Flt3l and IDBG-488510 and ENSMUSG00000089989 and 14256, FLT3LG and IDBG-640541 and ENSBTAG00000038045 and 282233
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products