Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Anti-IL7R/CD127 Picoband Antibody

Anti-IL7R/CD127 Picoband Antibody is available 1 time from Boster labs

PB9948 | Anti-IL7R/CD127 Picoband Antibody size: 100µg/vial | 443.78 USD

Catalog number PB9948
Supplier boster
Price 443.78 USD
Size 100µg/vial
1. Gene info
Identity6024
GeneIL7R
Synonyms
GenBank acession
Locus5p13.2
Discovery year1991-08-07
Pubmed identfication
Havana BLAST/BLATOTTHUMG00000090791
MeSH Data
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
Clonality Polyclonal
Storage & Transport Conditions At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
Form Lyophilized
Product Datasheet www.bosterbio.com/datasheet.php?sku=PB9948
Sample Size Available 30ug for $99, contact us for details
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ), different from the related mouse sequence by nine amino acids.
Purification Immunogen affinity purified.
Applications WB
Cross-reactivity No cross reactivity with other proteins
Ig Type N/A
Application Details Western blot, 0.1-0.5µg/ml, Human, Rat
Reactivity Human, Rat
Reconstitution Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Description This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetIL7R/CD127 Picoband
Short name Anti-IL7R/CD127 Picoband Antibody
Technique Antibody, anti
Alternative name antibody to-interleukin 7 receptor/CD127 Picoband (Antibody to)
Alternative technique antibodies
Alternative to gene target interleukin 7 receptor, CD127 and CDW127 and IL-7R-alpha and IL7RA and ILRA, IL7R and IDBG-16161 and ENSG00000168685 and 3575, protein binding, Extracellular, Il7r and IDBG-129135 and ENSMUSG00000003882 and 16197, IL7R and IDBG-630353 and ENSBTAG00000019975 and 521554
Similar products
Goat anti CD127 IL7R mouse Antibody Suppplier: MyBioSource
Price: 0.00 USD
anti CD127 IL7R Antibody Suppplier: acr
Price: 394.85 USD
Goat anti-CD127 / IL7R (mouse) Antibody Suppplier: MBS Polyclonals
Price: 421.02 USD
Mouse anti Human IL7RA/CD127 Monoclonal Antibody Suppplier: MyBioSource
Price: 327.72 USD
Anti-MVP Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-IGF2R Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-GLO1/Glyoxalase I Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-SOX10 Picoband antibody Suppplier: boster
Price: 443.78 USD
Anti-STAT2 Picoband antibody Suppplier: boster
Price: 443.78 USD
Mouse, Anti-Vinculin (VCL) Monoclonal Antibody-Monoclonal antibody Suppplier: Cloud Clone Corp
Price: 1 172.04 USD
Anti-HTRA1/Htra Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-XRCC1 Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-PRDM1/Blimp1 Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-Psoriasin Picoband antibody Suppplier: boster
Price: 489.30 USD
Anti-PERK Picoband antibody Suppplier: boster
Price: 443.78 USD
Anti-p38 Antibody Polyclonal antibody Suppplier: QED Biosciences
Price: 391.84 USD
Ask
Ajax processing
Close
Anti-IL7R/CD127 Picoband Antibody - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee