Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Mouse Interleukin 22 IL-22

Recombinant Mouse Interleukin 22 IL-22 is available 10 times from Novo labs

CM72-1000 | Recombinant Mouse Interleukin-22/IL-22 size: 1 mg | 2,781.09 USD

Loading

CM72-10 | Recombinant Mouse Interleukin-22/IL-22 size: 10 ug | 227.10 USD

Loading

CM72-500 | Recombinant Mouse Interleukin-22/IL-22 size: 500 ug | 1,964.44 USD

Loading

CM71-1000 | Recombinant Mouse Interleukin-22/IL-22 (C-mFc) size: 1 mg | 2,553.99 USD

Loading

CM71-10 | Recombinant Mouse Interleukin-22/IL-22 (C-mFc) size: 10 ug | 175.64 USD

Loading

CM71-50 | Recombinant Mouse Interleukin-22/IL-22 (C-mFc) size: 50 ug | 413.92 USD

Loading

CM71-500 | Recombinant Mouse Interleukin-22/IL-22 (C-mFc) size: 500 ug | 1,805.58 USD

Loading

C047-1000 | Recombinant Mouse Interleukin-22/IL-22 (E. coli) size: 1 mg | 3,054.05 USD

Catalog number C047-1000
Supplier novo
Price 3,054.05 USD
Size 1 mg
Description Recombinant Mouse Interleukin-22 is produced by our E.coli expression system and the target gene encoding Leu34-Val179 is expressed.
Origin Escherichia coli
Peptide sequence MLPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV
Estimated molecular weight 16,7 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Gene targetInterleukin-22/IL-22
Short name Recombinant Mouse Interleukin-22/IL-22 ( )
Species E. coli
Alternative name recombinant Mouse Interleukin-22/Interleukin-22 (E. coli)
1. Gene info
Identity5984
GeneIL17D
Long gene nameinterleukin 17D
Synonyms name
GenBank acession
Discovery year2000-05-02
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000016521
2. Gene info
Identity14900
GeneIL22
Long gene nameinterleukin 22
GenBank acession
Locus12q15
Discovery year2001-03-12
Pubmed identfication
RefSeq identity
Havana BLAST/BLAT OTTHUMG00000169119
Locus Specific Databases
  • LRG_1248
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Mouse#.jpg

C047-10 | Recombinant Mouse Interleukin-22/IL-22 (E. coli) size: 10 ug | 227.10 USD

Loading

C047-50 | Recombinant Mouse Interleukin-22/IL-22 (E. coli) size: 50 ug | 555.99 USD

Loading
Species reactivity Mouse
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q9JJY9
Test Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin name Mus musculus
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant, Mouse
Host mouse
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Mouse Interleukin-22/IL-22 (E. coli) size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • Interleukin-22/IL-22
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee