Recombinant Mouse Nucleophosmin(Npm1)

• Catalog number
  RPC20406
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  Q61937
• Gene number
  Npm1
• Other name
  Nucleolar phosphoprotein B23; Nucleolar protein NO38; Numatrin
• Protein origin
  E.coli
• Protein region
  1-292aa
• Protein sequence
  MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
• Information about sequence
  Full Length
• Expected molecular weight
  48.12kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Nucleophosmin   Npm1  
• Gene symbol
  NPM1
• Short name
  Recombinant Mouse Nucleophosmin(Npm1)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Nucleophosmin(nucleophosmin (nucleolar phosphoprotein B23, numatrin))
• Alternative technique
  rec, murine
• Alternative to gene target
  nucleophosmin (nucleolar phosphoprotein B23, numatrin), B23 and NPM, NPM1 and IDBG-57453 and ENSG00000181163 and 4869, unfolded protein binding, nuclei

Gene info

• Identity
  HGNC:7910
• Gene
  NPM1
• Long gene name
  nucleophosmin 1
• Synonyms gene name
  • nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  • nucleophosmin
• Synonyms
  • B23
  • NPM
• Synonyms name
  • nucleolar phosphoprotein B23
  • numatrin
  • nucleophosmin/nucleoplasmin family, member 1
• GenBank acession
  • M26697
• Locus
  5q35.1
• Discovery year
  1993-08-24
• Entrez gene record
  4869
• Pubmed identfication
  • 8471164
  • 8122112
• RefSeq identity
  • NM_002520
• VEGA ID
  OTTHUMG00000130465
• Locus Specific Databases
  • LRG_458

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products