FGB Antibody

  • Catalog number
    A01204-1
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    FGB
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the FGB Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The FGB Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
  • Related articles
    1. "Entrez Gene: FGB fibrinogen beta chain". 2. Chung, D. W., Que, B. G., Rixon, M. W., Mace, M., Jr., Davie, E. W. Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen. Biochemistry 22: 3244-3250, 1983. 3. Spena, S., Duga, S., Asselta, R., Malcovati, M., Peyvandi, F., Tenchini, M. L. Congenital afibrinogenemia: first identification of splicing mutations in the fibrinogen B-beta-chain gene causing activation of cryptic splice sites. Blood 100: 4478-4484, 2002.
  • Gene Name
    FGB
  • Protein Name
    Fibrinogen beta chain
  • Gene Full Name
    fibrinogen beta chain
  • Synonyms
    FGB | Fibrinogen beta chain | Fibrinopeptide B | HEL S 78p | HEL-S-78p | P02675
  • Uniprot ID
    P02675
  • Entrez GeneID
    2244
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    FGB  
  • Gene symbol
    FGB
  • Short name
    FGB Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    fibrinogen beta chain (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    fibrinogen beta chain, HEL-S-78p, FGB and IDBG-42021 and ENSG00000171564 and 2244, protein binding, Extracellular, Fgb and IDBG-154611 and ENSMUSG00000033831 and 110135, FGB and IDBG-628961 and ENSBTAG00000022120 and 510522
Gene info
  • Identity
  • Gene
    FGB
  • Long gene name
    fibrinogen beta chain
  • Synonyms gene name
    • fibrinogen, B beta polypeptide
  • Locus
  • Discovery year
    2001-06-22
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Fibrinogen C domain containing
    • Receptor ligands
  • VEGA ID
  • Locus Specific Databases
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee