ABCA1 Antibody

  • Catalog number
    R31847
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    ABCA1
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the ABCA1 antibody should be determined by the researcher.
  • Intented use
    This ABCA1 antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    O95477
  • Purity
    Antigen affinity
  • Description
    ABCA1 (ATP-binding cassette, sub-family A (ABC1), member 1), also known as ABC1, the cholesterol efflux regulatory protein (CERP) is a protein which in humans is encoded by the ABCA1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes contain 2,261 amino acids. Dot blot analysis of 50 tissues revealed ubiquitous expression of ABCA1 mRNA, with highest expression in placenta, liver, lung, adrenal glands, and all fetal tissues examined, and lowest expression in kidney, pancreas, pituitary, mammary gland, and bone marrow. This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterolefflux pump in the cellular lipid removal pathway. Using human ABCA1 expressed in the membrane fraction of sf9 insect cells, Szakacs et al. found specific, Mg(2+)-dependent ATP binding and low basal ATPase activity. Addition of potential lipid substrates or lipid acceptors did not modify the ATPase activity or nucleotide occlusion by ABCA1. Szakacs et al. speculated that ABCA1 may be a regulatory protein or may require other protein partners for full activation.
  • Immunogen
    Amino acids KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV of human ABCA1 were used as the immunogen for the ABCA1 antibody.
  • Storage
    After reconstitution, the ABCA1 antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    ABCA1  
  • Gene symbol
    ABCA1
  • Short name
    Anti-ABCA1
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to ABCA1
  • Alternative technique
    antibodies
  • Alternative to gene target
    ATP-binding cassette, sub-family A (ABC1), member 1, ABC-1 and ABC1 and CERP and HDLDT1 and TGD, ABCA1 and IDBG-79441 and ENSG00000165029 and 19, ATPase binding, Cell surfaces, Abca1 and IDBG-147642 and ENSMUSG00000015243 and 11303, BT.89249 and IDBG-637291 and ENSBTAG00000020661 and 535379
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee