GMF-gamma, human recombinant

  • Catalog number
    4879-1000
  • Price
    Please ask
  • Size
    1 mg
  • Synonyms
    Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867
  • Alternative_names
    Glia maturation factor gamma, GMF-gamma, GMFG, MGC126867
  • Description
    Mediates the pluripotentiality & lineage commitment of human hematopoietic stem cells
  • Recombinant
    Yes
  • Source
    E. coli
  • Purity by SDS PAGE
    ≥90%
  • Assay
    SDS-PAGE
  • Molecular Weight
    16.8 kDa
  • Storage Temp
    -20°C
  • Shipping
    Blue ice
  • Shelf Life
    12 months
  • Appearance
    Liquid
  • Physical form description
    Sterile Filtered colorless clear solution of GMF-gamma protein containing 20 mM Tris-HCl pH-8, 1mM DTT, 1mM EDTA and 10 % Glycerol.
  • Background Information
    GMFG is a hematopoietic-specific protein that mediates the pluripotentiality and lineage commitment of human hematopoietic stem cells. Glia maturation factor gamma is a cytokine-responsive protein in EPO-induced and G-CSF-induced hematopoietic lineage development. Glia maturation factor also acts as a Nerve Growth Factor in nervous system development, angiogenesis and immune function. GMFG possesses hematopoietic tissue-specific gene expression, a promoter concentrated with high-score hematopoiesis-specific transcription factors, and molecular coevolution with a rudimentary blood/immune system. Glia Maturation Factor-Gamma (GMF-Gamma) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 142 amino acids and having a total molecular mass of 16.8 kDa. Glia Maturation Factor-Gamma, GMF-Gamma, Human Recombinant is purified by proprietary chromatographic techniques.
  • Amino acid sequence
    MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
  • Handling
    Centrifuge the vial prior to opening.
  • Usage
    For Research Use Only! Not to be used in humans
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Additional source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    GMFB
  • Short name
    GMF-gamma, recombinant
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    GMF-g, H. sapiens Rec.
  • Alternative technique
    rec
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee