Recombinant Human BH3-Interacting Domain Death Agonist/BID

  • Catalog number
    C106-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human BH3-Interacting Domain Death Agonist is produced by our E.coli expression system and the target gene encoding Met1-Asp195 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
  • Estimated molecular weight
    21,99 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM PB, 100mM KCl, pH 7.4.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    P55957
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    BID
  • Short name
    Recombinant BH3-Interacting Domain Death Agonist/BID
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human BID
  • Alternative technique
    rec
  • Alternative to gene target
    BH3 interacting domain death a this GO nist, FP497, BID and IDBG-1050 and ENSG00000015475 and 101929618,637, ubiquitin protein ligase binding, Plasma membranes, Bid and IDBG-184076 and ENSMUSG00000004446 and 12122, BID and IDBG-641320 and ENSBTAG00000013988 and 510373,782484
Gene info
  • Identity
  • Gene
    BID
  • Long gene name
    BH3 interacting domain death agonist
  • GenBank acession
  • Locus
  • Discovery year
    1998-04-20
  • Entrez gene record
    637
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • MicroRNA protein coding host genes
    • BCL2 homology region 3 (BH3) only
    • Receptor ligands
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee