Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human C C Motif Chemokine 5 CCL5 RANTES

Recombinant Human C C Motif Chemokine 5 CCL5 RANTES is available 5 times from Novo labs

C062-1000 | Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES size: 1 mg | 2,526.60 USD

Catalog number C062-1000
Supplier novo
Price 2,526.60 USD
Size 1 mg
Description Recombinant Human C-C Motif Chemokine 5 is produced by our E.coli expression system and the target gene encoding Ser24-Ser91 is expressed.
Origin Escherichia coli
Peptide sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Estimated molecular weight 7,8 kDa
Package form Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Gene targetC-C Motif Chemokine 5/CCL5/RANTES
Short name Recombinant C-C Motif Chemokine 5/CCL5/RANTES
Technique Recombinant
Alternative name recombinant H. sapiens C-C Motif Chemokine 5/CCL5/RANTES
1. Gene info
Identity10632
GeneCCL5
Synonyms gene
Synonyms gene name
  • small inducible cytokine A5 (RANTES)
  • chemokine (C-C motif) ligand 5
GenBank acession
Locus17q12
Discovery year1990-07-05
Pubmed identfication
RefSeq identity
Havana BLAST/BLAT OTTHUMG00000188396
2. Gene info
Identity14013
GeneSMC4
Synonyms gene
Synonyms gene name
  • SMC4 (structural maintenance of chromosomes 4, yeast)-like 1
  • SMC4 structural maintenance of chromosomes 4-like 1 (yeast)
Synonyms
GenBank acession
Locus3q25.33
Discovery year2001-02-22
Pubmed identfication
Havana BLAST/BLATOTTHUMG00000159006
3. Gene info
Identity1604
GeneCCR3
Synonyms gene
Synonyms gene name
  • chemokine (C-C motif) receptor 3
GenBank acession
Locus3p21.31
Discovery year1995-05-30
Havana BLAST/BLATOTTHUMG00000133484
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C062-10 | Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES size: 10 ug | 187.03 USD

Loading

C062-500 | Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES size: 500 ug | 1,786.21 USD

Loading

CJ28-10 | Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES (C-Fc-6His) size: 10 ug | 224.66 USD

Loading

CJ28-50 | Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES (C-Fc-6His) size: 50 ug | 550.03 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number P13501
Description Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Species Human
Alternative technique rec
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES size: 1
Filters
+32-(0)1-658-90-45 [email protected]
  • C-C
  • Motif
  • Chemokine
  • 5/CCL5/RANTES
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee