CNTF, rat recombinant

• Catalog number
  4019-1000
• Price
  Please ask
• Size
  1 mg

• Synonyms
  HCNTF, CNTF, Ciliary Neurotrophic Factor.
• Alternative_names
  HCNTF, CNTF, Ciliary Neurotrophic Factor.
• Description
  A potent neural factor promoting survivability and differentiation of neuronal cell types.
• Recombinant
  Yes
• Source
  E. coli
• Purity by SDS PAGE
  ≥99%
• Assay
  SDS-PAGE
• Biological activity
  Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
• Molecular Weight
  22.834 kDa
• Storage Temp
  -20°C
• Shipping
  Gel pack
• Shelf Life
  12 months
• Appearance
  Lyophilized protein
• Physical form description
  Lyophilized from 0.025 % NaHCO₃
• Reconstitution Instructions
  Centrifuge the vial prior to opening. Reconstitute in sterile ddH₂O or 0.4 % NaHCO₃ adjusted to pH 8-9 to a concentration ≥ 100 µg/ml. This solution can then be diluted into other aqueous buffer, preferably in the presence of carrier protein.
• Background Information
  CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. CNTF is a survival factor for various neuronal cell types and seems to prevent the degeneration of motor axons after axotomy. CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
• Amino acid sequence
  AFAEQTPLTLHRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
• Handling
  Centrifuge the vial prior to opening.
• Usage
  For Research Use Only! Not to be used in humans
• Datasheet
• About
  Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
• Latin name
  Rattus norvegicus
• Additional source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CNTF  
• Gene symbol
  ZFP91-CNTF, CNTF
• Short name
  CNTF, recombinant
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Rat
• Species
  Rat, Rats
• Alternative name
  ciliary neurotrophic factor, rat Rec.
• Alternative technique
  rec
• Alternative to gene target
  ciliary neurotrophic factor, HCNTF, CNTF and IDBG-409278 and ENSG00000242689 and 1270, growth factor activity, Extracellular, Cntf and IDBG-254935 and ENSMUSG00000079415 and 12803, CNTF and IDBG-637978 and ENSBTAG00000003624 and 100848228

Gene info

• Identity
  HGNC:33441
• Gene
  ZFP91-CNTF
• Long gene name
  ZFP91-CNTF readthrough (NMD candidate)
• GenBank acession
  • AB057443
• Locus
  11q12.1
• Discovery year
  2011-05-31
• Entrez gene record
  386607
• Pubmed identfication
  • 12738986
• RefSeq identity
  • NR_024091
• VEGA ID
  OTTHUMG00000166280

Gene info

• Identity
  HGNC:2169
• Gene
  CNTF
• Long gene name
  ciliary neurotrophic factor
• Synonyms
  • HCNTF
• Synonyms name
  • Ciliary Neuronotrophic Factor
• GenBank acession
  • BC068030
• Locus
  11q12.1
• Discovery year
  1991-01-07
• Entrez gene record
  1270
• Pubmed identfication
  • 1840538
  • 1714745
• RefSeq identity
  • NM_000614
• Classification
  • Interleukin 6 type cytokine family
• VEGA ID
  OTTHUMG00000137476
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products