Recombinant Rickettsia japonica 17 kDa surface antigen(omp)

  • Catalog number
    RPC20380
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Rickettsia japonica (strain ATCC VR-1363 / YH)
  • Protein number
    Q52764 
  • Gene number
    omp
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    20-159aa
  • Protein sequence
    CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN
  • Information about sequence
    Full Length
  • Expected molecular weight
    31.4kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method. The kilo Daltons subunit weight of Recombinant Rickettsia japonica 17 surface antigen(omp) compared to your protein ladder can be shifted a little due to electrophoresis effects. 1 kDa = 1000 g/mol protein
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Rickettsia japonica 17 surface antigen(omp)
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Alternative name
    Rec. Rickettsia japonica 17 kiloDalton surface protein(omp)
  • Alternative technique
    rec, antigenes
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee