Recombinant Mouse CD160 (C-6His)

• Catalog number
  CU16-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Mouse CD160 Antigen is produced by our Mammalian expression system and the target gene encoding Gly28-Ser160 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Mouse
• Origin
  Human cells
• Peptide sequence
  GCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSHHHHHH
• Estimated molecular weight
  15.8
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q8VC80
• Other related products
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  CD160   C-6His  
• Gene symbol
  CD160
• Short name
  Recombinant Mouse CD160 (C-6His)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Recombinant Mouse CD160 (C-6His)
• Alternative technique
  rec, murine
• Alternative to gene target
  CD160 molecule, BY55 and NK1 and NK28, CD160 and IDBG-101772 and ENSG00000117281 and 11126, MHC class I receptor activity, Plasma membranes, Cd160 and IDBG-176450 and ENSMUSG00000038304 and 54215

Gene info

• Identity
  HGNC:17013
• Gene
  CD160
• Long gene name
  CD160 molecule
• Synonyms gene name
  • CD160 antigen
• Synonyms
  • BY55
  • NK1
  • NK28
• GenBank acession
  • AF060981
• Locus
  1q21.1
• Discovery year
  2003-10-02
• Entrez gene record
  11126
• Pubmed identfication
  • 9743336
  • 9973372
• RefSeq identity
  • NM_007053
• Classification
  • Immunoglobulin like domain containing
  • CD molecules
• VEGA ID
  OTTHUMG00000013749

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products