Recombinant Human S100 Calcium Binding Protein A9/S100A9/MRP14

  • Catalog number
    C795-10
  • Price
    Please ask
  • Size
    10 ug
  • Description
    Recombinant Human S100 Calcium Binding Protein A9 is produced by our E.coli expression system and the target gene encoding Thr2-Pro114 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
  • Estimated molecular weight
    13,2 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P06702
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A9, S100A1, S100Z, S100A8
  • Short name
    Recombinant S100 Calcium Binding Protein A9/S100A9/MRP14
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human S100 Calcium Binding Protein A9/MRP14
  • Alternative technique
    rec
  • Alternative to gene target
    S100 calcium binding protein A9, 60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, RAGE receptor binding, nuclei, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee