Rabbit ERMAP antibody

• Catalog number
  70R-7347
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Cell Biology
• Immunogen
  ERMAP antibody was raised using a synthetic peptide corresponding to a region with amino acids RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERMAP antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  ERMAP  
• Gene symbol
  ERMAP
• Short name
  Rabbit ERMAP antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal ERMAP antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  erythroblast membrane-associated protein (Scianna blood group), ERMAP and IDBG-97277 and ENSG00000164010 and 114625, protein binding, Plasma membranes, Ermap and IDBG-182483 and ENSMUSG00000028644 and 27028

Gene info

• Identity
  HGNC:15743
• Gene
  ERMAP
• Long gene name
  erythroblast membrane associated protein (Scianna blood group)
• Synonyms gene
  • RD
  • SC
• Synonyms gene name
  • Radin blood group
  • Scianna blood group
  • erythroblast membrane-associated protein
  • erythroblast membrane-associated protein (RD and SC blood groups)
  • erythroblast membrane-associated protein (Scianna blood group)
• Synonyms
  • BTN5
• GenBank acession
  • AF311284
• Locus
  1p34.2
• Discovery year
  2001-09-06
• Entrez gene record
  114625
• Pubmed identfication
  • 11549310
• RefSeq identity
  • NM_018538
• Classification
  • V-set domain containing
  • Butyrophilins
  • Blood group antigens
• VEGA ID
  OTTHUMG00000007619
• Locus Specific Databases
  • Blood Group Antigen Mutation Database
  • LRG_806

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products