TGFBR1 Antibody / TGF beta receptor I

• Catalog number
  R32569
• Price
  Please ask
• Size
  0.1mg

• Category
  Antibody
• Concentration
  0.5mg/ml if reconstituted with 0.2ml sterile DI water
• Form
  Antigen affinity purified
• Conjugation
  Unconjugated
• Clone
  Polyclonal antibody
• Recognised antigen
  TGFBR1 / TGF beta receptor I
• Host animal
  Rabbit (Oryctolagus cuniculus)
• Clonality
  Polyclonal (rabbit origin)
• Species reactivity
  Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
• Tested applications
  WB
• Recommended dilutions
  Western blot: 0.5-1ug/ml
• Added buffer
  Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
• Intented use
  This TGF beta receptor I antibodyis to be used only for research purposes and not for diagnostics..
• Uniprot
  P36897
• Purity
  Antigen affinity
• Description
  Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.
• Immunogen
  Amino acids 149-186 (HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT from the human protein were used as the immunogen for the TGF beta receptor I antibody.
• Storage
  After reconstitution, the TGF beta receptor I antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
• Properties
  If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Additional description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• French translation
  anticorps

• Gene target
  TGFBR1   TGF   beta   receptor  
• Gene symbol
  TGFBR1
• Short name
  Anti- TGFBR1 / TGF beta receptor I
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Isotype
  Rabbit IgG
• Alternative name
  Antibodies to TGFBR1 / TGF beta receptor I
• Alternative technique
  antibodies
• Alternative to gene target
  transforming growth factor, beta receptor 1, AAT5 and ACVRLK4 and ALK-5 and ALK5 and ESS1 and LDS1 and LDS1A and LDS2A and MSSE and SKR4 and TGFR-1, TGFBR1 and IDBG-78488 and ENSG00000106799 and 7046, transforming growth factor beta receptor activity, Cell surfaces, Tgfbr1 and IDBG-146050 and ENSMUSG00000007613 and 21812, TGFBR1 and IDBG-634152 and ENSBTAG00000018035 and 282382

Gene info

• Identity
  HGNC:11772
• Gene
  TGFBR1
• Long gene name
  transforming growth factor beta receptor 1
• Synonyms gene
  • MSSE
  • ESS1
• Synonyms gene name
  • multiple self-healing squamous epithelioma
  • transforming growth factor beta receptor I
• Synonyms
  • ALK-5
  • ACVRLK4
  • ALK5
  • TBRI
  • TBR-i
• Synonyms name
  • activin A receptor type II-like kinase, 53kDa
• Locus
  9q22.33
• Discovery year
  1993-09-30
• Entrez gene record
  7046
• Pubmed identfication
  • 1319842
  • 8530052
  • 21358634
• Classification
  • Type 1 receptor serine/threonine kinases
• VEGA ID
  OTTHUMG00000020353
• Locus Specific Databases
  • LOVD - Center for Medical Genetics, Ghent, Belgium

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products