TGFBR1 Antibody / TGF beta receptor I
-
Catalog number
R32569
-
Price
Please ask
-
Size
0.1mg
-
-
Category
Antibody
-
Concentration
0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
Form
Antigen affinity purified
-
Conjugation
Unconjugated
-
Clone
Polyclonal antibody
-
Recognised antigen
TGFBR1 / TGF beta receptor I
-
Host animal
Rabbit (Oryctolagus cuniculus)
-
Clonality
Polyclonal (rabbit origin)
-
Species reactivity
Human (Homo sapiens), Mouse (Mus musculus), Rat ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applications
WB
-
Recommended dilutions
Western blot: 0.5-1ug/ml
-
Added buffer
Lyophilized from 1X Phosphate Buffered Saline (PBS) with 2.5% BSA and 0.025% sodium azide
-
Intented use
This TGF beta receptor I antibodyis to be used only for research purposes and not for diagnostics..
-
Uniprot
P36897
-
Purity
Antigen affinity
-
Description
Transforming growth factor, beta receptor I is a TGF beta receptor. TGFBR1 is its human gene. The protein encoded by this gene forms a heteromeric complex with type II TGF-beta receptors when bound to TGF-beta, transducing the TGF-beta signal from the cell surface to the cytoplasm. Mutations in this gene have been associated with Loeys-Dietz aortic aneurysm syndrome (LDAS). TGFB1 regulates cell cycle progression by a unique signaling mechanism that involves its binding to TGFBR2 and activation of TGFBR1. Both are transmembrane serine/threonine receptor kinases. The TGFBR1 receptor may be inactivated in many of the cases of human tumor cells refractory to TGFB-mediated cell cycle arrest.
-
Immunogen
Amino acids 149-186 (HNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTT from the human protein were used as the immunogen for the TGF beta receptor I antibody.
-
Storage
After reconstitution, the TGF beta receptor I antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
Properties
If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
-
Gene target
-
Gene symbol
TGFBR1
-
Short name
Anti- TGFBR1 / TGF beta receptor I
-
Technique
Antibody, antibodies against human proteins, antibodies for
-
Isotype
Rabbit IgG
-
Alternative name
Antibodies to TGFBR1 / TGF beta receptor I
-
Alternative technique
antibodies
-
Alternative to gene target
transforming growth factor, beta receptor 1, AAT5 and ACVRLK4 and ALK-5 and ALK5 and ESS1 and LDS1 and LDS1A and LDS2A and MSSE and SKR4 and TGFR-1, TGFBR1 and IDBG-78488 and ENSG00000106799 and 7046, transforming growth factor beta receptor activity, Cell surfaces, Tgfbr1 and IDBG-146050 and ENSMUSG00000007613 and 21812, TGFBR1 and IDBG-634152 and ENSBTAG00000018035 and 282382
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products