SUR2A Antibody: Biotin
-
Catalog numberSMC-431D-BI
-
PricePlease ask
-
Size100 µg
-
-
Alternative NameSUR2A Antibody, Clone S319A-14: Biotin
-
Other nameMouse Anti-Mouse SUR2A Monoclonal IgG2A
-
TargetSUR2A
-
ConjugateBiotin
-
CategoryAntibodies
-
Product TypeMonoclonal
-
Clone NumberS319A-14
-
ImmunogenFusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
-
Immunogen SpeciesMouse
-
Gene ID20928
-
Swiss ProtP70170
-
ApplicationsWB , IHC , ICC/IF
-
Host SpeciesMouse
-
Species ReactivityMouse , Rat
-
Storage BufferPBS pH7.4, 50% glycerol, 0.09% sodium azide
-
Concentration1 mg/ml
-
SpecificityDetects ~120kDa. Does not cross-react with SUR2B.
-
Storage Temperature-20°C
-
Shipping TemperatureBlue Ice or 4°C
-
PropertiesIf you buy Antibodies supplied by StressMarq they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. Biotin conjugates can be detected by horseradish peroxidase, alkaline phosphatase substrates or anti biotin conjugated antibodies. Avidin and Streptavidin bind to the small biotin and are couple to HRP or AP for ELISA. To break the streptavidin Biotin bond we suggest to use a 6 molar guanidine HCl solution with acidity of pH 1.6.
-
ConjugationBiotinylated
-
French translationanticorps
-
Gene target
-
Short nameSUR2A Antibody:
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeIgG2A
-
LabelBiotin
-
Alternative nameSUR2A (antibody to-): biotinilated
-
Alternative techniqueantibodies
-
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data