ART4 Blocking Peptide

• Catalog number
  33R-9161
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Signal Transduction
• Tag Conjugate
  TLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTLFTIF
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  ART4  
• Gene symbol
  ART4
• Short name
  ART4 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  ADP-ribosyltransferase 4 (Dombrock blood group) inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  ADP-ribosyltransferase 4 (Dombrock blood group), ARTC4 and CD297 and DO and DOK1, ART4 and IDBG-21245 and ENSG00000111339 and 420, NAD(P)+-protein-arginine ADP-ribosyltransferase activity, Plasma membranes, Art4 and IDBG-195079 and ENSMUSG00000030217 and 109978, ART4 and IDBG-639284 and ENSBTAG00000008352 and 407146

Gene info

• Identity
  HGNC:726
• Gene
  ART4
• Long gene name
  ADP-ribosyltransferase 4 (inactive) (Dombrock blood group)
• Synonyms gene
  • DO
• Synonyms gene name
  • Dombrock blood group
  • ADP-ribosyltransferase 4 (DO blood group)
  • ADP-ribosyltransferase 4
  • ADP-ribosyltransferase 4 (Dombrock blood group)
• Synonyms
  • DOK1
  • CD297
  • ARTC4
• Synonyms name
  • NAD(+)--protein-arginine ADP-ribosyltransferase 4
• GenBank acession
  • X95826
• Locus
  12p12.3
• Discovery year
  1998-05-11
• Entrez gene record
  420
• Pubmed identfication
  • 9119374
• RefSeq identity
  • NM_021071
• Classification
  • Blood group antigens
  • ADP-ribosyltransferase family
  • CD molecules
• VEGA ID
  OTTHUMG00000168738
• Locus Specific Databases
  • LRG_807

Similar products