Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Escherichia coli Beta lactamase bla

Recombinant Escherichia coli Beta lactamase bla is available 24 times from Bioma labs

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 500 μg | 1,197.98 USD

Catalog number RPC20118
Supplier bioma
Price 1,197.98 USD
Size 500 μg
Protein number P28585
Other name Beta-lactamase MEN-1Cefotaximase 1
Protein origin E.coli
Protein region 29-291aa
Protein sequence QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Expected molecular weight 32.3kDa
Protein purity ≥ 90%
Gene targetEscherichia coli Beta-lactamase CTX-M-1(bla
Short name Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)
Alternative name recombinant Escherichia coli b-lactamase CTX-M-1(bla)
1. Gene info
Identity 2329
Gene CPT1B
Long gene name carnitine palmitoyltransferase 1B
Synonyms gene name
  • carnitine palmitoyltransferase 1B (muscle)
Synonyms
  • M-CPT1
  • CPT1-M
Synonyms name
  • carnitine O-palmitoyltransferase 1B
GenBank acession
  • U62733
Locus 22q13.33
Discovery year 1996-08-14
Entrez gene record 1375
Pubmed identfication
  • 9070950
RefSeq identity
  • NM_152246
Havana BLAST/BLAT OTTHUMG00000137390
MeSH Data
Name Primary Cell Culture
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 200 μg | 773.46 USD

Loading

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 500 μg | 1,197.98 USD

Loading

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 10 μg | 183.36 USD

Loading

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 50 μg | 347.84 USD

Loading

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 100 μg | 514.53 USD

Loading

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 200 μg | 773.46 USD

Loading

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 10 μg | 183.36 USD

Loading

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 100 μg | 514.53 USD

Loading

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 50 μg | 347.84 USD

Loading

RPC20118 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 1 mg | 1,776.97 USD

Loading

RPC20255 | Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) size: 1 mg | 1,776.97 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 1 mg | 1,776.97 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 1 mg | 1,776.97 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 50 μg | 347.84 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 50 μg | 347.84 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 200 μg | 773.46 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 200 μg | 773.46 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 100 μg | 514.53 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 500 μg | 1,197.98 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 500 μg | 1,197.98 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 100 μg | 514.53 USD

Loading

RPC20126 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 10 μg | 183.36 USD

Loading

RPC20260 | Recombinant Escherichia coli Beta-lactamase TEM(bla) size: 10 μg | 183.36 USD

Loading
Use before 1 year
Information about sequence Full Length
Storage recommendation Aliquot and store at -20°C. Minimize freezing and thawing.
Estimated production time 7-11 business days
Shipping requirements Blue ice
Verified reactivity Escherichia coli (strain K12)
Gene number bla
Gene name bla
Notes For research use only. Not for diagnostic procedures.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Host Escherichia coli
Alternative technique rec
Similar products
Recombinant Beta-lactamase SHV-24 (bla) Suppplier: MyBioSource
Price: 872.37 USD
Recombinant Beta-lactamase (blaF) Suppplier: MyBioSource
Price: 872.37 USD
Recombinant Escherichia coli Beta lactamase Suppplier: SAB
Price: 306.72 USD
Escherichia coli Beta lactamase ampC Suppplier: MBS Recombinant
Price: 2 247.05 USD
Recombinant Beta lactamase blaA Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase OXY bla Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Escherichia coli Beta lactamase bla Suppplier: Biomatik
Price: 0.00 USD
Recombinant Escherichia coli Beta lactamase Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase blaZ Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase SHV 2 bla Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase regulatory protein BlaB blaB Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase CTX M bla Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase SHV 8 bla Suppplier: MyBioSource
Price: 0.00 USD
Recombinant Beta lactamase SHV 6 bla Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla) sku
Filters
+32-(0)1-658-90-45 [email protected]
  • Escherichia
  • coli
  • Beta-lactamase
  • CTX-M-1(bla
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee