Rat Natural HO-1 Protein

  • Catalog number
    SPR-318A
  • Price
    Please ask
  • Size
    50 µg
  • Stock availability
    In Stock
  • Scientific context
    Heme-oxygenase is a ubiquitous enzyme that catalyzes the initial and rate-limiting steps in heme catabolism yielding equimolar amounts of biliverdin, iron and carbon monoxide. Biliverdin is subsequently converted to bilirubin and the free iron is sequestered to ferritin (1). These products have important physiological effects as carbon monoxide is a potent vasodilator; biliverdin and bilirubin are potent antioxidants; and the free iron increases oxidative stress and regulates the expression of many mRNAs (2). There are three isoforms of heme-oxygenase, HO-1, HO-2 and HO-3; however HO-1 and HO-2 are the major isoforms as they both have been identified in mammals (3). HO-1, also known as heat shock protein 32, is an inducible isoform activated by most oxidative stress inducers, cytokines, inflammatory agents and heat shock. HO-2 is a constitutive isoform which is expressed under homeostatic conditions. HO-1 is also considered to be a cytoprotective factor in that free heme is highly reactive and cytotoxic, and secondly, carbon monoxide is a mediator inhibiting the inflammatory process and bilirubin is a scavenger for reactive oxygen, both of which are the end products of heme catalyzation (4). It has also been shown that HO-1 deficiency may cause reduced stress defense, a pro-inflammatory tendency (5), susceptibility to atherosclerotic lesion formation (6), endothelial cell injury, and growth retardation (7). Up-regulation of HO-1 is therefore said to be one of the major defense mechanisms of oxidative stress (4).
  • Protein target
    HO-1
  • Protein reactivity
    Rat
  • Certificate of analysis
    This product has been certified >90% pure using SDS - PAGE analysis.
  • Protein description
    Rat Natural HO-1 Full Length Protein
  • Other name
    Heme oxygenase 1 Protein, HSP32 Protein, Hemox Protein, 32 kD Protein, bK286B10 Protein, D8Wsu38e Protein, heat shock protein 32kD Protein, Heat shock Protein, Heme oxygenase (decycling) 1 Protein, HMOX 1 Protein, Hmox Protein, HMOX1 Protein, HO 1 Protein, HO Protein, HO1 Protein
  • Primary research area
    Cancer, Oxidative Stress
  • Category
    Protein
  • Brand name
    none
  • Origin
    Natural
  • NCBI number
    NP_036712.1
  • Gene number
    24451
  • Protein number
    P06762
  • Verified applications
    WB, SDS-PAGE
  • Relevant bio activity
    HO-1 Protein
  • Protein expression model
    Native
  • Protein charasterics
    Full Length
  • Peptide sequence
    MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGKSQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM
  • Protein purification
    Ion-exchange Purified
  • Purity pourcentage
    >90% High purity
  • Recommended buffer for storage
    20mM Tris pH7.5, 0.1mM EDTA, 0.1% triton x-100, 0.2% Na cholate,
  • Protein concentration
    Lot/batch specific. See included datasheet.
  • Protein specificity
    ~33 kDa
  • Protein tag
    No tag
  • Storage recommendations
    -80°C
  • Shipping recommendations
    Blue Ice or 4°C
  • Supplementary useful information
    Please see included datasheet or contact us
  • Protein cell localization
    Microsome, Endoplasmic Reticulum
  • Bibliography
    1. Froh M. et al. (2007) World J. Gastroentereol 13(25): 3478-86. 2. Elbirt K.K. and Bonkovsky H.L. (1999) Proc Assoc Am Physicians 111(5): 348-47. 3. Maines M.D., Trakshel G.M., and Kutty R.K. (1986) J Biol Chem 261: 411–419. 4. Brydun A., et al. (2007) Hypertens Res 30(4): 341-8. 5. Poss K.D. and Tonegawa S. (1997). Proc Natl Acad Sci U S A. 94: 10925–10930. 6. Yet S.F., et al. (2003) FASEB J. 17: 1759–1761. 7. Yachie A., et al. (1999) J Clin Invest. 103: 129–135.
  • Release date
    5-Jan-2015
  • PubMed number
    Not added. Please refer to PubMed
  • Tested applications
    to be tested
  • Tested species reactivity
    to be tested
  • Representative figure
    No Representative Data Available.
  • Representative figure legend
    No Representative Data Available.
  • Warnings
    Non-hazardous materials
  • Protein origin
    Canada
  • Total weight kg
    1.4
  • Net weight g
    0.05
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Gene target
    Natural   HO-1   Protein  
  • Gene symbol
    HMOX1, HMOX2, IGHVII-1-1, MIR1-1, TRUND-NNN8-1, TRUND-NNN7-1, IGKV1OR2-1, MIR1289-1, MIR101-1, MIR16-1
  • Short name
    Natural HO-1 Protein
  • Host
    Rat
  • Species
    Rat, Rats
  • Alternative name
    Rat Natural HO-1 Protein
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable (II)-1-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable (II)-1-1
    • immunoglobulin heavy variable (II)-1-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 8-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 8-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 7-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 7-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 1/OR2-1 (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin kappa variable 1/OR-1
    • immunoglobulin kappa variable 1/OR-1 pseudogene
    • immunoglobulin kappa variable 1/OR-1 (pseudogene)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
  • VEGA ID
Gene info
Gene info
Gene info
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee