Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

C11ORF53 antibody

C11ORF53 antibody is available 1 time from Fitzgerald labs

70R-3724 | C11ORF53 antibody size: 50 µg | 563.16 USD

Catalog number 70R-3724
Supplier fitzgerald
Price 563.16 USD
Size 50 µg
1. Gene info
Identity 30527
Gene C11orf53
Long gene name chromosome 11 open reading frame 53
Synonyms
  • MGC50104
GenBank acession
  • BC039669
Locus 11q23.1
Discovery year 2006-02-06
Entrez gene record 341032
Pubmed identfication
  • 25048349
RefSeq identity
  • NM_198498
Havana BLAST/BLAT OTTHUMG00000166656
Category Primary Antibody
Antibody Subtype Polyclonal Antibodies, Purified
Area of research DNA & RNA
Type of Immunogen C11ORF53 antibodies were raised using the middle region of C11Orf53 corresponding to a region with amino acids SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN
Raised in Rabbit
Specificity C11ORF53 antibody was raised against the middle region of C11Orf53
Cross Reactivity Human,Rat
Method of Purification Affinity purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C11ORF53 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1 ug/ml
Assay Information C11ORF53 Blocking Peptide, catalog no. 33R-8522, is also available for use as a blocking control in assays to test for specificity of this C11ORF53 antibody
Additional Information This is a rabbit polyclonal antibody against C11orf53, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetC11ORF53
Short name C11ORF53 antibody
Technique Antibody
Alternative name Rabbit polyclonal C11ORF53 antibody raised against the middle region of C11Orf53
Alternative technique antibodies
Similar products
C11orf53 antibody Suppplier: genways
Price: 617.70 USD
SMPD3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) Suppplier: ABM lentivectors
Price: 613.55 USD
Pirfenidone 5g Suppplier: ChemScene
Price: 490.84 USD
CADM2 Antibody Suppplier: EnoGene
Price: 444.60 USD
Mouse ACTN1 antibody Suppplier: fitzgerald
Price: 409.03 USD
2.6 dichloro 4 N methylpyridine 3.4 diamine Suppplier: ChemScene
Price: 385.32 USD
C11orf53 Antibody Suppplier: abbex
Price: 360.42 USD
ALDH1A1 Polyclonal Antibody Suppplier: Abbkine
Price: 331.97 USD
C11orf53 Antibody Suppplier: Bioss Primary Unconjugated Antibodies
Price: 311.81 USD
Tulobuterol hydrochloride Suppplier: MedChemExpress
Price: 308.26 USD
Rabbit RAD18 Polyclonal Antibody Suppplier: ABclonal
Price: 275.06 USD
Septin 3 Blocking Peptide sequence Suppplier: fabgen
Price: 258.70 USD
Dynactin 4 Blocking Peptide Suppplier: fitzgerald
Price: 248.98 USD
IPKB Antibody[IPKB] Suppplier: MyBioSource
Price: 5.93 USD
Methanothermobacter thermautotrophicus 3 isopropylmalate Suppplier: MBS Recombinant
Price: 1 815.15 USD
Recombinant Pinus thunbergii Protein Suppplier: MyBioSource
Price: 0.00 USD
Pyridine 2 chloro 9CI Suppplier: SFC
Price: 0.00 USD
UBL3 cDNA Clone Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
C11ORF53 antibody | Technique alternative | 01011914671
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • C11ORF53
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee