Anti-CYP3A4/Cytochrome P450 3A4 Picoband Antibody

  • Catalog number
    PB10055
  • Price
    Please ask
  • Size
    100µg/vial
  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross reactivity
    No cross reactivity with other proteins
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Immunohistochemistry(Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat Western blot, 0.1-0.5µg/ml, Human
  • Applications
    IHC, WB
  • Reactivity
    Human
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=PB10055
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    CYP3A4, CYP3A7, CYP24A1, CYP1A1, CYP51A1, CYP2D6
  • Short name
    Anti-CYP3A4/Cytochrome P450 3A4 Picoband Antibody
  • Technique
    Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
  • Host
    Rabbit
  • Isotype
    N/A
  • Alternative name
    Antibody toCYP3A4/Cytochrome P450 3A4 Picoband (antibody to-)
  • Alternative technique
    antibodies
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    cytochrome P450 family 24 subfamily A member 1
  • Synonyms gene
  • Synonyms gene name
    • cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
    • cytochrome P450, family 24, subfamily A, polypeptide 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1992-09-09
  • Entrez gene record
  • Classification
    • Cytochrome P450 family 24
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    cytochrome P450 family 51 subfamily A member 1
  • Synonyms gene
  • Synonyms gene name
    • cytochrome P450, 51 (lanosterol 14-alpha-demethylase)
    • cytochrome P450, family 51, subfamily A, polypeptide 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1996-10-26
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Cytochrome P450 family 51
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee