Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, E. coli)

• Catalog number
  CH31-50
• Price
  Please ask
• Size
  50 ug

• Description
  Recombinant Human NGAL is produced by our E.coli expression system and the target gene encoding Gln21-Gly198 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGVEHHHHHH
• Estimated molecular weight
  21,8 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Dry ice/ice packs
• Package form
  Supplied as a 0.2 µm filtered solution of PBS,50% glycerol,pH7.4.
• Storage conditions
  Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
• Reconstitution conditions
  Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• UniProt number
  P80188
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  NGAL/Lipocalin-2/LCN2   C-6His  
• Gene symbol
  LCN2
• Short name
  Recombinant NGAL/Lipocalin-2/LCN2 (C-6His, )
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  e. coli, Escherichia coli, Recombination of bioactive proteins and longer peptides in Escherichia Coli is done often with His tagging. novo supplies Rec. E. Coli affinity purified or tag purified antigens in 1 quantities or bulk volumes on request.
• Species
  E. coli, E. coli, Humans
• Alternative name
  Human NGAL/Lipocalin-2/LCN2(E.coli,C-6His)
• Alternative technique
  rec, escherichia
• Alternative to gene target
  lipocalin 2, 24p3 and MSFI and NGAL, LCN2 and IDBG-87415 and ENSG00000148346 and 3934, protein homodimerization activity, Extracellular, Lcn2 and IDBG-160059 and ENSMUSG00000026822 and 16819, BT.61865 and IDBG-639105 and ENSBTAG00000014149 and 526639

Gene info

• Identity
  HGNC:6526
• Gene
  LCN2
• Long gene name
  lipocalin 2
• Synonyms gene name
  • lipocalin 2 (oncogene 24p3)
• Synonyms
  • NGAL
  • 24p3
• Synonyms name
  • oncogene 24p3
  • neutrophil gelatinase-associated lipocalin
  • siderocalin
• Locus
  9q34.11
• Discovery year
  1994-04-29
• Entrez gene record
  3934
• Pubmed identfication
  • 7683678
• RefSeq identity
  • NM_005564
• Classification
  • Lipocalins
• VEGA ID
  OTTHUMG00000020734

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products