FGG Blocking Peptide

• Catalog number
  33R-3672
• Price
  Please ask
• Size
  100 ug

• Product Type
  Proteins
• Product Subtype
  Blocking Peptides
• Research Area
  Cell Biology
• Tag Conjugate
  GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ
• Type1
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Applications
  WB, IHC
• Shipping Info
  Blue Ice
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  FGG  
• Gene symbol
  FGG
• Short name
  FGG Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  fibrinogen gamma chain inhibiting short protein sequence
• Alternative technique
  control, peptides
• Alternative to gene target
  fibrinogen gamma chain, FGG and IDBG-42165 and ENSG00000171557 and 2266, protein binding, Extracellular, Fgg and IDBG-154510 and ENSMUSG00000033860 and 99571, FGG and IDBG-628944 and ENSBTAG00000006745 and 280792

Gene info

• Identity
  HGNC:3694
• Gene
  FGG
• Long gene name
  fibrinogen gamma chain
• Synonyms gene name
  • fibrinogen, gamma polypeptide
• Locus
  4q32.1
• Discovery year
  2001-06-22
• Entrez gene record
  2266
• RefSeq identity
  • NM_021870
• Classification
  • Fibrinogen C domain containing
  • Receptor ligands
• VEGA ID
  OTTHUMG00000150329
• Locus Specific Databases
  • LOVD EAHAD Coagulation Factor Variant Database
  • LRG_585

Similar products