Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Rabbit TAP1 antibody

Rabbit TAP1 antibody is available 2 times from Fitzgerald labs

70R-5960 | Rabbit TAP1 antibody size: 50 ug | 546.63 USD

Catalog number 70R-5960
Supplier fitzgerald
Price 546.63 USD
Size 50 ug
Applications WB
Immunogen TAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL
Cross Reactivity Human,Mouse
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TAP1 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping Info Blue Ice
1. Gene info
Synonyms gene
Synonyms gene name
  • transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Discovery year1992-06-25
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000031067
2. Gene info
Synonyms gene
Synonyms gene name
  • TAP1 and PSMB8 antisense RNA 1
Discovery year2013-07-25
RefSeq identity
Havana BLAST/BLATOTTHUMG00000140123
MeSH Data
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200

70R-20704 | Rabbit TAP1 antibody size: 50 ul | 579.76 USD

Research Area Cell Biology
Product Subtype Purified Polyclonal Antibodies
Specificity NA
Product Type Primary Antibodies
Clone NA
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
About Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
Latin name Oryctolagus cuniculus
French translation anticorps
Gene targetTAP1
Short name Rabbit TAP1 antibody
Technique Antibody, Rabbit
Host Rabbit
Alternative name Rabbit polyclonal TAP1 antibody
Alternative technique antibodies
Alternative to gene target transporter 1, ATP-binding cassette, sub-family B (MDR/TAP), ABC17 and ABCB2 and APT1 and D6S114E and PSF-1 and PSF1 and RING4 and TAP1*0102N and TAP1N, TAP1 and IDBG-81568 and ENSG00000168394 and 6890, ATPase activity, Plasma membranes, Tap1 and IDBG-170616 and ENSMUSG00000037321 and 21354, TAP1 and IDBG-628856 and ENSBTAG00000008953 and 524959
Similar products
Rabbit AGBL4 antibody Suppplier: fitzgerald
Price: 601.84 USD
Rabbit DAB2 antibody Suppplier: fitzgerald
Price: 579.76 USD
Rabbit MTOR antibody Suppplier: fitzgerald
Price: 579.76 USD
Rabbit DCUN1D5 antibody Suppplier: fitzgerald
Price: 579.76 USD
Rabbit METAP1 antibody Suppplier: fitzgerald
Price: 546.63 USD
Rabbit KRTAP1-5 antibody Suppplier: fitzgerald
Price: 546.63 USD
Rabbit Aak1 antibody Suppplier: fitzgerald
Price: 546.63 USD
Rabbit FLJ37543 antibody Suppplier: fitzgerald
Price: 546.63 USD
Rabbit STAT5a antibody Suppplier: fitzgerald
Price: 491.41 USD
Rabbit DHEA 15 antibody Suppplier: fitzgerald
Price: 488.10 USD
Rabbit ZNF592 antibody Suppplier: fitzgerald
Price: 469.33 USD
Rabbit MEKKK1 antibody Suppplier: fitzgerald
Price: 469.33 USD
Rabbit MRGX4 antibody Suppplier: fitzgerald
Price: 469.33 USD
Rabbit OR51F2 antibody Suppplier: fitzgerald
Price: 469.33 USD
TP53 Rabbit Polyclonal Antibody Suppplier: aviva
Price: 403.07 USD
Rabbit Anti Annexin A3 ANXA3 Polyclonal antibody Suppplier: Cloud Clone Corp
Price: 1 711.67 USD
Ajax processing
Rabbit TAP1 antibody size: 50 ug -
+32-(0)1-658-90-45 [email protected]
  • TAP1
Contact us
Ajax processing
Chat with employee