Recombinant Human E3 Ubiquitin-Protein Ligase CHIP/CHIP

  • Catalog number
    C115-1000
  • Price
    Please ask
  • Size
    1 mg
  • Description
    Recombinant Human STUB1 is produced by our E.coli expression system and the target gene encoding Met1-Tyr303 is expressed.
  • Species reactivity
    Human
  • Origin
    Escherichia coli
  • Peptide sequence
    MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
  • Estimated molecular weight
    34,86 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • UniProt number
    Q9UNE7
  • Properties
    Precipitation of Chromatins is a pull down technique of native DNA sequences by specific binding proteins on which on the other side of the protein the antibody can bind. Lots of antibodies are not suited for Chip analysis pulldown because they bind on the binding site of the DNA. The novo antibody is proven to not bind on the DNA binding site and is suitable for ChiP precipitation supplied in 1 vials. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    ITCH, HECTD3, PRKN
  • Short name
    Recombinant E3 Ubiquitin-Protein Ligase CHIP/CHIP
  • Technique
    Recombinant, ChiP, Chromatine immuno Precipitationg antibody, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human STUB1/CHIP
  • Alternative technique
    rec, epigenetics
Gene info
  • Identity
  • Gene
  • Long gene name
    itchy E3 ubiquitin protein ligase
  • Synonyms gene name
    • itchy (mouse homolog) E3 ubiquitin protein ligase
    • itchy E3 ubiquitin protein ligase homolog (mouse)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2001-04-27
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • C2 domain containing
    • HECT domain containing
    • MicroRNA protein coding host genes
  • VEGA ID
  • Locus Specific Databases
Gene info
  • Identity
  • Gene
  • Long gene name
    HECT domain E3 ubiquitin protein ligase 3
  • Synonyms gene name
    • HECT domain containing E3 ubiquitin protein ligase 3
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2005-07-07
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • HECT domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee