FSCN3 Blocking Peptide

• Catalog number
  33R-10067
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Protein Modification & Stress Response
• Residues
  YDGEVRAASERLNRMSLFQFECDSESPTVQLRSANGYYLSQRRHRAVMAD
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  FSCN3  
• Gene symbol
  FSCN3
• Short name
  FSCN3 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of FSCN3 antibody, catalog no. 70R-9247
• Alternative technique
  control, peptides
• Alternative to gene target
  fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus), FSCN3 and IDBG-39375 and ENSG00000106328 and 29999, protein binding, Cytoplasm, Fscn3 and IDBG-130574 and ENSMUSG00000029707 and 56223, FSCN3 and IDBG-634962 and ENSBTAG00000009365 and 511917

Gene info

• Identity
  HGNC:3961
• Gene
  FSCN3
• Long gene name
  fascin actin-bundling protein 3
• Synonyms gene name
  • fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, testicular)
  • fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus)
  • fascin actin-bundling protein 3, testicular
• Locus
  7q32.1
• Discovery year
  2000-02-29
• Entrez gene record
  29999
• Pubmed identfication
  • 11925108
• RefSeq identity
  • NM_020369
• Classification
  • Fascin family
• VEGA ID
  OTTHUMG00000022935

Similar products