Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)

  • Catalog number
    CU15-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Mouse Phospholipase A2 is produced by our Mammalian expression system and the target gene encoding Ala16-Cys146 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    AHSISPRAVWQFRNMIKCTIPGSDPLKDYNNYGCYCGLGGWGTPVDDLDRCCQTHDHCYSQAKKLESCKFLIDNPYTNTYSYSCSGSEITCSAKNNKCEDFICNCDREAAICFSKVPYNKEYKNLDTGKFCHHHHHH
  • Estimated molecular weight
    15.6
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Dry Ice/ice packs
  • Package form
    Supplied as a 0.2 µm filtered solution of 20mM HEPES,150mM NaCl,pH 7.0.
  • Storage conditions
    Store at below -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q9Z0Y2
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PLA2G1B
  • Short name
    Recombinant Mouse Phospholipase A2 Group IB/PLA2G1B (C-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse PLA2G1B (C-6His)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    phospholipase A2, group IB (pancreas), PLA2 and PLA2A and PPLA2, PLA2G1B and IDBG-60467 and ENSG00000170890 and 5319, calcium-dependent phospholipase A2 activity, Extracellular, Pla2g1b and IDBG-193845 and ENSMUSG00000029522 and 18778, PLA2G1B and IDBG-634759 and ENSBTAG00000026732 and 282457
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee