-
Target antigen
ANGPTL4
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
rat
-
Analyses
WB,ELISA
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ANGPTL4 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ANGPTL4 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.
-
Related articles
1. Romeo, S., Pennacchio, L. A., Fu, Y., Boerwinkle, E., Tybjaerg-Hansen, A., Hobbs, H. H., Cohen, J. C.Population-based resequencing of ANGPTL4 uncovers variations that reduce triglycerides and increase HDL. Nature Genet. 39: 513-516, 2007. 2. Yoon, J. C., Chickering, T. W., Rosen, E. D., Dussault, B., Qin, Y., Soukas, A., Friedman, J. M., Holmes, W. E., Spiegelman, B. M.Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. Molec. Cell. Biol. 20: 5343-5349, 2000.
-
Gene Name
ANGPTL4
-
Protein Name
Angiopoietin-related protein 4
-
Gene Full Name
angiopoietin-like 4
-
Synonyms
Angiopoietin like 4 | Angiopoietin related protein 4 | Angiopoietinlike 4 | angiopoietin-like 4 | Angiopoietin-like 4 | Angiopoietin-like protein 4 | Angiopoietinrelated protein 4 | ANGL4 | angptl 4 | ANGPTL2 | ANGPTL4 | ARP4 | PGAR | HFARP | pp1158 | PSEC0166 | TGQTL | Q9BY76
-
Uniprot ID
Q9BY76
-
Entrez GeneID
51129
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
