VEGF120, murine recombinant

• Catalog number
  4964-10
• Price
  Please ask
• Size
  10 ug

• Synonyms
  Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609, VPF, glioma derived endothelial cell mitogen.
• Alternative_names
  Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGF, MGC70609.
• Description
  A signaling protein involved in both vasculogenesis and angiogenesis
• Recombinant
  Yes
• Source
  E. coli
• Purity by SDS PAGE
  ≥97%
• Assay
  SDS-PAGE
• Purity
  ≥97%
• Biological activity
  The activity as determined by dose-dependent proliferation of human umbilical vein endothelial cells (HUVEC) was typically found to be 1-5 ng/ml.
• Results
  1-5 ng/ml
• Molecular Weight
  28.2 kDa
• Storage Temp
  -20°C
• Shipping
  Blue ice
• Shelf Life
  12 months
• Appearance
  Lyophilized protein
• Physical form description
  Sterile filtered and lyophilized with no additives
• Reconstitution Instructions
  Reconstitute the lyophilized product with sterile H₂O at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions
• Background Information
  Vascular Endothelial Growth factor-A (VEGF-A) was originally isolated from tumor cells and is produced by a wide variety of cell types. In addition to stimulating vascular growth and permeability, VEGF-A may play a role in stimulating vasodilatation via nitric oxide-dependent pathways. Mouse VEGF-A has several variants, one being VEGF-120 (also known as VEGF-2). Recombinant Mouse VEGF-120 is a homodimer with a molecular weight of 28.2 kDa.
• Amino acid sequence
  MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
• Handling
  Centrifuge the vial prior to opening.
• Usage
  For Research Use Only! Not to be used in humans
• Datasheet
• Additional source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  VEGF120   murine  
• Short name
  VEGF120, murine recombinant
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. Biovision advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Alternative name
  VEGF120, murine Rec.
• Alternative technique
  rec

MeSH Data

• Name
  Urine Specimen Collection
• Concept
  Scope note: Methods or procedures used to obtain samples of URINE.
• Tree numbers
  • E01.370.225.998.762
  • E05.200.998.762
• Qualifiers
  ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data

Product images

Similar products