Recombinant Mouse Platelet Endothelial Cell Adhesion Molecule/CD31/PECAM-1 (C-6His)

  • Catalog number
    CU23-500
  • Price
    Please ask
  • Size
    500 ug
  • Description
    Recombinant Mouse Platelet Endothelial Cell Adhesion Molecule is produced by our Mammalian expression system and the target gene encoding Glu18-Lys590 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Mouse
  • Origin
    Human cells
  • Peptide sequence
    EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQESFSTPKFEIKPPGMIIEGDQLHIRCIVQVTHLVQEFTEIIIQKDKAIVATSKQSSEAVYSVMAMVEYSGHYTCKVESNRISKASSIMVNITELFPKPKLEFSSSRLDQGELLDLSCSVSGTPVANFTIQKEETVLSQYQNFSKIAEESDSGEYSCTAGIGKVVKRSGLVPIQVCEMLSKPSIFHDAKSEIIKGHAIGISCQSENGTAPITYHLMKAKSDFQTLEVTSNDPATFTDKPTRDMEYQCRADNCHSHPAVFSEILRVRVIAPVDEVVISILSSNEVQSGSEMVLRCSVKEGTSPITFQFYKEKEDRPFHQAVVNDTQAFWHNKQASKKQEGQYYCTASNRASSMRTSPRSSTLAVRVFLAPWKKHHHHHH
  • Estimated molecular weight
    63,4 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    Q08481
  • Additional description
    cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Mouse Platelet Endothelial Adhesion Molecule/CD31/PECAM-1 (C-6His). For cells, cell lines and tissues in culture till half confluency. Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits. Platelets, also called thrombocytes or cloth cells in blood and are needed to stop bleeding by clumping and clotting the blood the vessels when the an injury occurs. Teh bone marrow will produce the platelets that have no nucleus. Platelates are unique to mammals, the are curved shaped 1900nm to 3100 nm large nucleus free clothing structures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    PECAM1, IGHVII-1-1, MIR1-1, TRUND-NNN8-1, TRUND-NNN7-1, IGKV1OR2-1, MIR1289-1, MIR101-1, MIR16-1
  • Short name
    Recombinant Mouse Platelet Endothelial Adhesion Molecule/CD31/PECAM-1 (C-6His)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Recombinant Mouse CD31 (C-6His)
  • Alternative technique
    rec, murine
  • Tissue
    cell
Gene info
  • Identity
  • Gene
  • Long gene name
    platelet and endothelial cell adhesion molecule 1
  • Synonyms gene name
    • platelet/endothelial cell adhesion molecule 1
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1995-11-29
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • CD molecules
    • Immunoglobulin like domain containing
    • Ig-like cell adhesion molecule family
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable (II)-1-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable (II)-1-1
    • immunoglobulin heavy variable (II)-1-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 8-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 8-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    tRNA-undetermined (NNN) 7-1
  • Synonyms gene name
    • transfer RNA-undetermined (NNN) 7-1
  • GenBank acession
  • Locus
    1
  • Discovery year
    2014-06-20
  • Entrez gene record
  • Pubmed identfication
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin kappa variable 1/OR2-1 (pseudogene)
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin kappa variable 1/OR-1
    • immunoglobulin kappa variable 1/OR-1 pseudogene
    • immunoglobulin kappa variable 1/OR-1 (pseudogene)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-18
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Immunoglobulin kappa (IGK) orphons
  • VEGA ID
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee