Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

KIAA1199 antibody

KIAA1199 antibody is available 2 times from Fitzgerald labs

70R-5460 | KIAA1199 antibody size: 50 µg | 568.12 USD

Catalog number 70R-5460
Supplier fitzgerald
Price 568.12 USD
Size 50 µg
Area of research Signal Transduction
Type of Immunogen KIAA1199 antibodies were raised using the middle region of KIAA1199 corresponding to a region with amino acids PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD
Specificity KIAA1199 antibody was raised against the middle region of KIAA1199
Cross Reactivity Human
Method of Purification Affinity purified
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1199 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Shipping conditions Blue Ice
Tested for WB
Usage Recommendations WB: 1 ug/ml
Assay Information KIAA1199 Blocking Peptide, catalog no. 33R-7080, is also available for use as a blocking control in assays to test for specificity of this KIAA1199 antibody
Additional Information This is a rabbit polyclonal antibody against KIAA1199, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
MeSH Data
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200

70R-18106 | KIAA1199 antibody size: 50 µl | 568.12 USD

Loading
Category Primary Antibody
Raised in Rabbit
Product Subtype Purified Polyclonal Antibodies
Antibody Subtype Polyclonal Antibodies, Purified
Product Type Primary Antibodies
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetKIAA1199
Short name KIAA1199 antibody
Technique Antibody
Alternative name KIAA1199 (Antibody to)
Alternative technique antibodies
Similar products
KIAA1199 antibody Suppplier: MyBioSource
Price: 655.77 USD
Rabbit KIAA1199 antibody Suppplier: fitzgerald
Price: 582.54 USD
KIAA1199 antibody Suppplier: genways
Price: 578.10 USD
KIAA1199 antibody - middle region Suppplier: aviva
Price: 347.30 USD
Ask
Ajax processing
Close
KIAA1199 antibody size: 50 µg - Gentaur.com
Filters
+32-(0)1-658-90-45 [email protected]
  • KIAA1199
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee