-
Target antigen
NQO1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human NQO1 (242-274aa EVQDEEKNKKFGLSVGHHLGKSIPTDNQIKARK), different from the related mouse and rat sequences by five amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the NQO1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The NQO1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. And this FAD-binding protein forms homodimers and reduces quinones to hydroquinones. In addition, this protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
-
Related articles
1. "Entrez Gene: NQO1 NAD(P)H dehydrogenase, quinone 1". 2. Jaiswal AK (Nov 1991). "Human NAD(P)H:quinone oxidoreductase (NQO1) gene structure and induction by dioxin".Biochemistry x30 (44): 10647–53. 3. Ross D, Siegel D (2004). "NAD(P)H:quinone oxidoreductase 1 (NQO1, DT-diaphorase), functions and pharmacogenetics". Methods in Enzymology382: 115–44.
-
Gene Name
NQO1
-
Protein Name
NAD(P)H dehydrogenase [quinone] 1
-
Gene Full Name
NAD(P)H dehydrogenase, quinone 1
-
Synonyms
Azoreductase antibody|Cytochrome b 5 reductase antibody|DHQU antibody|DIA 4 antibody|DIA4 antibody|Diaphorase (NADH/NADPH) (cytochrome b 5 reductase) antibody|Diaphorase (NADH/NADPH) antibody|Diaphorase 4 antibody|Dioxin inducible 1 antibody|DT diaphorase antibody|DT-diaphorase antibody|DTD antibody|Menadione reductase antibody|NAD(P)H dehydrogenase [quinone] 1 antibody|NAD(P)H dehydrogenase quinone 1 antibody|NAD(P)H menadione oxidoreductase 1 dioxin inducible antibody|NAD(P)H: menadione oxidoreductase 1 dioxin inducible 1 antibody|NAD(P)H:menadione oxidoreductase 1 antibody|NAD(P)H:Quinone acceptor oxidoreductase type 1 antibody|NAD(P)H:quinone oxidoreductase 1 antibody| NAD(P)H:quinone oxireductase antibody|NMOR 1 antibody|NMOR I antibody|NMOR1 antibody|NMORI antibody|NQO 1 antibody|NQO1 antibody|NQO1_HUMAN antibody|Phylloquinone reductase antibody| QR 1 antibody|QR1 antibody|Quinone reductase 1 antibody
-
Uniprot ID
P15559
-
Entrez GeneID
1728
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
