Recombinant Human Microfibril-Associated Glycoprotein 4/MFAP4(C-6His)

• Catalog number
  CI81-1000
• Price
  Please ask
• Size
  1 mg

• Description
  Recombinant Human MFAP4 is produced by our Mammalian expression system and the target gene encoding Val22-Ala255 is expressed with a 6His tag at the C-terminus.
• Species reactivity
  Human
• Origin
  Human Cells
• Peptide sequence
  VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRAVDHHHHHH
• Estimated molecular weight
  27,5 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P55083
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Microfibril-Associated   Glycoprotein   4/MFAP4   C-6His  
• Gene symbol
  MFAP4
• Short name
  Recombinant Microfibril-Associated Glycoprotein 4/MFAP4(C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Human MFAP4(C-6His)
• Alternative technique
  rec
• Alternative to gene target
  microfibrillar-associated protein 4, MFAP4 and IDBG-34759 and ENSG00000166482 and 4239, protein binding, Extracellular, Mfap4 and IDBG-183000 and ENSMUSG00000042436 and 76293, MFAP4 and IDBG-637769 and ENSBTAG00000006187 and 286766

Gene info

• Identity
  HGNC:7035
• Gene
  MFAP4
• Long gene name
  microfibril associated protein 4
• Synonyms gene name
  • microfibrillar associated protein 4
• Synonyms name
  • microfibril-associated glycoprotein 4
• GenBank acession
  • L38486
• Locus
  17p11.2
• Discovery year
  1994-11-17
• Entrez gene record
  4239
• Pubmed identfication
  • 7633408
• RefSeq identity
  • NM_002404
• Classification
  • Fibrinogen C domain containing
• VEGA ID
  OTTHUMG00000059585

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products